+ USE_DATABASE_REPLICATED=0 + USE_SHARED_CATALOG=0 ++ rg -v '#' /usr/share/zoneinfo/zone.tab ++ awk '{print $3}' ++ shuf ++ head -n1 + TZ=Pacific/Gambier + echo 'Chosen random timezone Pacific/Gambier' + ln -snf /usr/share/zoneinfo/Pacific/Gambier /etc/localtime Chosen random timezone Pacific/Gambier + echo Pacific/Gambier + dpkg -i package_folder/clickhouse-common-static_24.8.14.10504.altinitytest_amd64.deb Selecting previously unselected package clickhouse-common-static. (Reading database ... 48426 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static_24.8.14.10504.altinitytest_amd64.deb ... Unpacking clickhouse-common-static (24.8.14.10504.altinitytest) ... Setting up clickhouse-common-static (24.8.14.10504.altinitytest) ... + dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10504.altinitytest_amd64.deb Selecting previously unselected package clickhouse-common-static-dbg. (Reading database ... 48453 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10504.altinitytest_amd64.deb ... Unpacking clickhouse-common-static-dbg (24.8.14.10504.altinitytest) ... Setting up clickhouse-common-static-dbg (24.8.14.10504.altinitytest) ... + dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10504.altinitytest_amd64.deb Selecting previously unselected package clickhouse-odbc-bridge. (Reading database ... 48460 files and directories currently installed.) Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10504.altinitytest_amd64.deb ... Unpacking clickhouse-odbc-bridge (24.8.14.10504.altinitytest) ... Setting up clickhouse-odbc-bridge (24.8.14.10504.altinitytest) ... + dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10504.altinitytest_amd64.deb Selecting previously unselected package clickhouse-library-bridge. (Reading database ... 48466 files and directories currently installed.) Preparing to unpack .../clickhouse-library-bridge_24.8.14.10504.altinitytest_amd64.deb ... Unpacking clickhouse-library-bridge (24.8.14.10504.altinitytest) ... Setting up clickhouse-library-bridge (24.8.14.10504.altinitytest) ... + dpkg -i package_folder/clickhouse-server_24.8.14.10504.altinitytest_amd64.deb Selecting previously unselected package clickhouse-server. (Reading database ... 48472 files and directories currently installed.) Preparing to unpack .../clickhouse-server_24.8.14.10504.altinitytest_amd64.deb ... Unpacking clickhouse-server (24.8.14.10504.altinitytest) ... Setting up clickhouse-server (24.8.14.10504.altinitytest) ... ClickHouse binary is already located at /usr/bin/clickhouse Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse. Creating symlink /usr/bin/ch to /usr/bin/clickhouse. Creating symlink /usr/bin/chl to /usr/bin/clickhouse. Creating symlink /usr/bin/chc to /usr/bin/clickhouse. Creating clickhouse group if it does not exist. groupadd -r clickhouse Creating clickhouse user if it does not exist. useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf. Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration. Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration. Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it. /etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path. /etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path. Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it. Log directory /var/log/clickhouse-server/ already exists. Creating data directory /var/lib/clickhouse/. Creating pid directory /var/run/clickhouse-server. chown -R clickhouse:clickhouse '/var/log/clickhouse-server/' chown -R clickhouse:clickhouse '/var/run/clickhouse-server' chown clickhouse:clickhouse '/var/lib/clickhouse/' groupadd -r clickhouse-bridge useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge' chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge' Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it. Setting capabilities for clickhouse binary. This is optional. chown -R clickhouse:clickhouse '/etc/clickhouse-server' ClickHouse has been successfully installed. Start clickhouse-server with: sudo clickhouse start Start clickhouse-client with: clickhouse-client + dpkg -i package_folder/clickhouse-client_24.8.14.10504.altinitytest_amd64.deb Selecting previously unselected package clickhouse-client. (Reading database ... 48489 files and directories currently installed.) Preparing to unpack .../clickhouse-client_24.8.14.10504.altinitytest_amd64.deb ... Unpacking clickhouse-client (24.8.14.10504.altinitytest) ... Setting up clickhouse-client (24.8.14.10504.altinitytest) ... + echo '' + [[ -z '' ]] + ch --query 'SELECT 1' 1 + chl --query 'SELECT 1' 1 + chc --version ClickHouse client version 24.8.14.10504.altinitytest (altinity build). + ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test + source /attach_gdb.lib ++ source /utils.lib +++ sysctl kernel.core_pattern=core.%e.%p-%P +++ sysctl fs.suid_dumpable=1 kernel.core_pattern = core.%e.%p-%P fs.suid_dumpable = 1 + source /utils.lib ++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P ++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + /usr/share/clickhouse-test/config/install.sh + DEST_SERVER_PATH=/etc/clickhouse-server + DEST_CLIENT_PATH=/etc/clickhouse-client +++ dirname /usr/share/clickhouse-test/config/install.sh ++ cd /usr/share/clickhouse-test/config ++ pwd -P Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server + SRC_PATH=/usr/share/clickhouse-test/config + echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server' + mkdir -p /etc/clickhouse-server/config.d/ + mkdir -p /etc/clickhouse-server/users.d/ + mkdir -p /etc/clickhouse-client + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/ + '[' /etc/clickhouse-server = /etc/clickhouse-server ']' + ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/ + ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml + value=1 + sed --follow-symlinks -i 's|[01]|1|' /etc/clickhouse-server/config.d/keeper_port.xml + value=41814016 + sed --follow-symlinks -i 's|[[:digit:]]\+|41814016|' /etc/clickhouse-server/config.d/keeper_port.xml + value=40798208 + sed --follow-symlinks -i 's|[[:digit:]]\+|40798208|' /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n '' ]] + [[ -n '' ]] + [[ '' == \1 ]] + [[ '' == \1 ]] + [[ -n 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/ + [[ -n 0 ]] + [[ 0 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml + [[ -n 0 ]] + [[ 0 -eq 1 ]] + ./setup_minio.sh stateless + azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log + export MINIO_ROOT_USER=clickhouse + MINIO_ROOT_USER=clickhouse + export MINIO_ROOT_PASSWORD=clickhouse + MINIO_ROOT_PASSWORD=clickhouse + main stateless + local query_dir ++ check_arg stateless ++ local query_dir ++ '[' '!' 1 -eq 1 ']' ++ case "$1" in ++ query_dir=0_stateless ++ echo 0_stateless + query_dir=0_stateless + '[' '!' -f ./minio ']' + start_minio + mkdir -p ./minio_data + ./minio --version minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3) Runtime: go1.22.5 linux/amd64 License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Copyright: 2015-2024 MinIO, Inc. + wait_for_it + local counter=0 + local max_counter=60 + local url=http://localhost:11111 + ./minio server --address :11111 ./minio_data + params=('--silent' '--verbose') + local params + curl --silent --verbose http://localhost:11111 + grep AccessDenied + [[ 0 == \6\0 ]] + echo 'trying to connect to minio' + sleep 1 trying to connect to minio Azurite Blob service is starting on 0.0.0.0:10000 Azurite Blob service successfully listens on http://0.0.0.0:10000 INFO: Formatting 1st pool, 1 set(s), 1 drives per set. INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable. MinIO Object Storage Server Copyright: 2015-2026 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:34255 http://127.0.0.1:34255 Docs: https://min.io/docs/minio/linux/index.html + counter=1 + curl --silent --verbose http://localhost:11111 + grep AccessDenied AccessDeniedAccess Denied./189B42CD30885CE37dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f + lsof -i :11111 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME minio 294 root 8u IPv6 38102 0t0 TCP *:11111 (LISTEN) minio 294 root 9u IPv4 38101 0t0 TCP localhost:11111 (LISTEN) minio 294 root 10u IPv6 38103 0t0 TCP localhost:11111 (LISTEN) + sleep 5 + setup_minio stateless + local test_type=stateless + ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse Added `clickminio` successfully. + ./mc admin user add clickminio test testtest Added user `test` successfully. + ./mc admin policy attach clickminio readwrite --user=test Attached Policies: [readwrite] To User: test + ./mc mb --ignore-existing clickminio/test Bucket created successfully `clickminio/test`. + '[' stateless = stateless ']' + ./mc anonymous set public clickminio/test Access permission for `clickminio/test` is set to `public` + upload_data 0_stateless /usr/share/clickhouse-test + local query_dir=0_stateless + local test_path=/usr/share/clickhouse-test + local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio + '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']' + ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/ `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv` Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 108.22 MiB/s + setup_aws_credentials + local minio_root_user=clickhouse + local minio_root_password=clickhouse + mkdir -p /root/.aws + cat + ./setup_hdfs_minicluster.sh + ls -lha total 125M drwxr-xr-x 1 root root 4.0K Mar 9 10:25 . drwxr-xr-x 1 root root 4.0K Mar 9 10:25 .. -rw-rw-r-- 1 1000 1000 119 Mar 9 10:19 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2.4K Jan 31 2025 attach_gdb.lib -rw-r--r-- 1 root root 1.3K Mar 9 10:25 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 3.9K Mar 9 10:25 __azurite_db_blob__.json -rw-r--r-- 1 root root 1.4K Mar 9 10:25 azurite_log lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin drwxr-xr-x 2 root root 4.0K Mar 9 10:25 __blobstorage__ drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 966 Mar 9 10:19 broken_tests.json drwxr-xr-x 14 root root 3.8K Mar 9 10:24 dev -rwxr-xr-x 1 root root 0 Mar 9 10:24 .dockerenv drwxr-xr-x 1 root root 4.0K Mar 9 10:25 etc drwxr-xr-x 10 1000 1000 4.0K Jun 14 2021 hadoop-3.3.1 drwxr-xr-x 2 root root 4.0K Apr 18 2022 home lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26M Jan 31 2025 mc drwxr-xr-x 2 root root 4.0K Sep 11 2024 media -rwxr-xr-x 1 root root 99M Jan 31 2025 minio drwxr-xr-x 4 root root 4.0K Mar 9 10:25 minio_data drwxr-xr-x 2 root root 4.0K Sep 11 2024 mnt drwxr-xr-x 1 root root 4.0K Jan 31 2025 opt -rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4.0K Mar 9 10:24 package_folder dr-xr-xr-x 310 root root 0 Mar 9 10:24 proc -rwxrwxr-x 1 root root 9.5K Jan 31 2025 process_functional_tests_result.py -rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt drwx------ 1 root root 4.0K Mar 9 10:25 root drwxr-xr-x 1 root root 4.0K Mar 9 10:25 run -rwxrwxr-x 1 root root 22K Jan 31 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin -rwxrwxr-x 1 root root 11K Jan 31 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3.4K Jan 31 2025 setup_minio.sh drwxr-xr-x 2 root root 4.0K Sep 11 2024 srv -rw-rw-r-- 1 root root 14K Jan 31 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Mar 9 10:24 sys drwxrwxr-x 2 1000 1000 4.0K Mar 9 10:24 test_output drwxrwxrwt 1 root root 4.0K Jan 31 2025 tmp drwxr-xr-x 1 root root 4.0K Sep 11 2024 usr -rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib drwxr-xr-x 1 root root 4.0K Sep 11 2024 var + cd hadoop-3.3.1 + export JAVA_HOME=/usr + JAVA_HOME=/usr + mkdir -p target/test/data + chown clickhouse ./target/test/data + nc -z localhost 12222 + sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222 + sleep 1 + nc -z localhost 12222 + sleep 1 + nc -z localhost 12222 + sleep 1 + nc -z localhost 12222 + lsof -i :12222 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME java 426 clickhouse 322u IPv4 22340 0t0 TCP localhost:12222 (LISTEN) java 426 clickhouse 544u IPv4 34293 0t0 TCP localhost:46042->localhost:12222 (ESTABLISHED) java 426 clickhouse 545u IPv4 15074 0t0 TCP localhost:12222->localhost:46042 (ESTABLISHED) + sleep 5 + config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml + set +x File /tmp/export-logs-config.sh does not exist, do not setup + [[ -n '' ]] + export IS_FLAKY_CHECK=0 + IS_FLAKY_CHECK=0 + '[' 1 -gt 1 ']' + sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for _ in {1..100} + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + sleep 1 + for _ in {1..100} + clickhouse-client --query 'SELECT 1' 127.0.0.1 - - [09/Mar/2026:19:25:43 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 - 127.0.0.1 - - [09/Mar/2026:19:25:43 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:25:43 +0000] "PUT /devstoreaccount1/cont/mpcazudxairhpbcrsdlhdierbkkyeaff HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:25:43 +0000] "GET /devstoreaccount1/cont/mpcazudxairhpbcrsdlhdierbkkyeaff HTTP/1.1" 206 4 127.0.0.1 - - [09/Mar/2026:19:25:43 +0000] "GET /devstoreaccount1/cont/mpcazudxairhpbcrsdlhdierbkkyeaff HTTP/1.1" 206 2 127.0.0.1 - - [09/Mar/2026:19:25:43 +0000] "DELETE /devstoreaccount1/cont/mpcazudxairhpbcrsdlhdierbkkyeaff HTTP/1.1" 202 - 1 + break + setup_logs_replication + set +x File /tmp/export-logs-config.sh does not exist, do not setup + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ ahxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 618 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ aehxB =~ e ]] + set_e=true + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + true + set -e + return + clickhouse-client --query 'CREATE TABLE minio_audit_logs ( log String, event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'') ) ENGINE = MergeTree ORDER BY tuple()' + clickhouse-client --query 'CREATE TABLE minio_server_logs ( log String, event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'') ) ENGINE = MergeTree ORDER BY tuple()' + ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500 Successfully applied new settings. + ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500 Successfully applied new settings. + max_retries=100 + retry=1 + '[' 1 -le 100 ']' + echo 'clickminio restart attempt 1:' clickminio restart attempt 1: ++ ./mc admin service restart clickminio --wait --json ++ jq -r .status INFO: Restarting on service signal MinIO Object Storage Server Copyright: 2015-2026 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:39121 http://127.0.0.1:39121 Docs: https://min.io/docs/minio/linux/index.html + output='success success' + echo 'Output of restart status: success success' + expected_output='success success' + '[' 'success success' = 'success success' ']' + echo 'Restarted clickminio successfully.' + break + '[' 1 -gt 100 ']' Output of restart status: success success Restarted clickminio successfully. + MC_ADMIN_PID=1500 + ./mc admin trace clickminio + export -f run_tests + '[' 1 -gt 1 ']' + run_tests + set -x + read -ra ADDITIONAL_OPTIONS + HIGH_LEVEL_COVERAGE=YES + '[' 1 -gt 1 ']' + [[ -n '' ]] + [[ -n '' ]] + [[ 0 -eq 1 ]] + [[ '' -eq 1 ]] + [[ 0 -eq 1 ]] ++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\''' + [[ 1 == 0 ]] + ADDITIONAL_OPTIONS+=('--jobs') + ADDITIONAL_OPTIONS+=('8') + [[ -n 0 ]] + [[ -n 2 ]] + ADDITIONAL_OPTIONS+=('--run-by-hash-num') + ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM") + ADDITIONAL_OPTIONS+=('--run-by-hash-total') + ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL") + HIGH_LEVEL_COVERAGE=NO + [[ -n '' ]] + [[ NO = \Y\E\S ]] + ADDITIONAL_OPTIONS+=('--report-logs-stats') + try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + local total_retries=10 + shift + fn_exists run_with_retry + declare -F run_with_retry + run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + [[ aehxB =~ e ]] + set_e=true + set +e + local total_retries=10 + shift + local retry=0 + '[' 0 -ge 10 ']' + clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + true + set -e + return + set +e + TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}") + clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 0 --run-by-hash-total 2 --report-logs-stats + ts '%Y-%m-%d %H:%M:%S' + tee -a test_output/test_result.txt 2026-03-09 10:26:01 Using queries from '/usr/share/clickhouse-test/queries' directory 2026-03-09 10:26:01 Connecting to ClickHouse server... OK 2026-03-09 10:26:01 Connected to server 24.8.14.10504.altinitytest @ 3f8604df3ea74ce2eab3ad4a7634c2bcdb7aa858 HEAD 2026-03-09 10:26:02 Found 3253 parallel tests and 281 sequential tests 2026-03-09 10:26:03 Running about 406 stateless tests (Process-8). 2026-03-09 10:26:03 00098_g_union_all: [ OK ] 0.42 sec. 2026-03-09 10:26:03 Running about 406 stateless tests (Process-9). 2026-03-09 10:26:03 00122_join_with_subquery_with_subquery: [ OK ] 0.42 sec. 2026-03-09 10:26:03 Running about 406 stateless tests (Process-10). 2026-03-09 10:26:03 02553_type_object_analyzer: [ OK ] 0.48 sec. 2026-03-09 10:26:03 Running about 406 stateless tests (Process-4). 2026-03-09 10:26:03 02681_comparsion_tuple_elimination_ast: [ OK ] 0.48 sec. 2026-03-09 10:26:03 Running about 406 stateless tests (Process-3). 2026-03-09 10:26:03 03002_analyzer_prewhere: [ OK ] 0.57 sec. 2026-03-09 10:26:03 Running about 406 stateless tests (Process-5). 2026-03-09 10:26:03 02381_analyzer_join_final: [ OK ] 0.57 sec. 2026-03-09 10:26:03 Running about 406 stateless tests (Process-7). 2026-03-09 10:26:03 03130_analyzer_self_join_group_by: [ OK ] 0.62 sec. 2026-03-09 10:26:03 Running about 406 stateless tests (Process-6). 2026-03-09 10:26:03 02293_h3_hex_ring: [ OK ] 0.78 sec. 2026-03-09 10:26:03 00876_wrong_arraj_join_column: [ OK ] 0.47 sec. 2026-03-09 10:26:03 00462_json_true_false_literals: [ OK ] 0.42 sec. 2026-03-09 10:26:03 03142_window_function_limit_by: [ OK ] 0.48 sec. 2026-03-09 10:26:03 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.42 sec. 2026-03-09 10:26:03 00810_in_operators_segfault: [ OK ] 0.42 sec. 2026-03-09 10:26:04 02763_row_policy_storage_merge_alias: [ OK ] 0.72 sec. 2026-03-09 10:26:04 02868_operator_is_not_distinct_from_priority: [ OK ] 0.47 sec. 2026-03-09 10:26:04 02861_filter_pushdown_const_bug: [ OK ] 0.57 sec. 2026-03-09 10:26:04 02872_prewhere_filter: [ OK ] 0.57 sec. 2026-03-09 10:26:04 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 0.67 sec. 2026-03-09 10:26:04 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 0.47 sec. 2026-03-09 10:26:04 01427_pk_and_expression_with_different_type: [ OK ] 0.42 sec. 2026-03-09 10:26:04 02842_vertical_merge_after_add_drop_column: [ OK ] 0.52 sec. 2026-03-09 10:26:04 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 0.48 sec. 2026-03-09 10:26:04 00712_prewhere_with_alias_bug_2: [ OK ] 0.47 sec. 2026-03-09 10:26:05 01147_partial_merge_full_join: [ OK ] 1.68 sec. 2026-03-09 10:26:05 02737_arrayJaccardIndex: [ OK ] 0.67 sec. 2026-03-09 10:26:05 02478_analyzer_table_expression_aliases: [ OK ] 0.62 sec. 2026-03-09 10:26:05 02834_formats_with_variable_number_of_columns: [ OK ] 0.62 sec. 2026-03-09 10:26:06 01419_merge_tree_settings_sanity_check: [ OK ] 0.57 sec. 2026-03-09 10:26:06 03271_decimal_monotonic_day_of_week: [ OK ] 0.48 sec. 2026-03-09 10:26:06 03303_alias_inverse_order: [ OK ] 0.47 sec. 2026-03-09 10:26:07 01505_trivial_count_with_partition_predicate: [ OK ] 0.78 sec. 2026-03-09 10:26:07 01308_orc_output_format_arrays: [ OK ] 2.63 sec. 2026-03-09 10:26:07 02002_system_table_with_tuple: [ OK ] 1.22 sec. 2026-03-09 10:26:07 02185_arraySlice_negative_offset_size: [ OK ] 0.57 sec. 2026-03-09 10:26:07 02771_if_constant_folding: [ OK ] 0.42 sec. 2026-03-09 10:26:07 03105_table_aliases_in_mv: [ OK ] 0.52 sec. 2026-03-09 10:26:08 03008_uniq_exact_equal_ranges: [ OK ] 4.49 sec. 2026-03-09 10:26:08 03148_asof_join_ddb_subquery: [ OK ] 0.47 sec. 2026-03-09 10:26:08 02771_skip_empty_files: [ OK ] 3.63 sec. 2026-03-09 10:26:08 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 0.92 sec. 2026-03-09 10:26:08 03031_tuple_elimination_analyzer: [ OK ] 0.53 sec. 2026-03-09 10:26:08 01825_new_type_json_parallel_insert: [ OK ] 0.62 sec. 2026-03-09 10:26:09 01700_mod_negative_type_promotion: [ OK ] 0.53 sec. 2026-03-09 10:26:09 02790_url_multiple_tsv_files: [ OK ] 1.48 sec. 2026-03-09 10:26:09 00794_materialized_view_with_column_defaults: [ OK ] 0.57 sec. 2026-03-09 10:26:09 01278_format_multiple_queries: [ OK ] 0.77 sec. 2026-03-09 10:26:09 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.62 sec. 2026-03-09 10:26:09 02366_kql_summarize: [ OK ] 0.87 sec. 2026-03-09 10:26:09 00227_quantiles_timing_arbitrary_order: [ OK ] 0.47 sec. 2026-03-09 10:26:09 03168_query_log_privileges_not_empty: [ OK ] 6.54 sec. 2026-03-09 10:26:09 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.57 sec. 2026-03-09 10:26:09 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec. 2026-03-09 10:26:09 Reason: not running for current build 2026-03-09 10:26:10 00950_default_prewhere: [ OK ] 0.62 sec. 2026-03-09 10:26:10 03305_fix_kafka_table_with_kw_arguments: [ OK ] 0.47 sec. 2026-03-09 10:26:10 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 0.52 sec. 2026-03-09 10:26:10 02995_index_6: [ SKIPPED ] 0.00 sec. 2026-03-09 10:26:10 Reason: not running for current build 2026-03-09 10:26:10 00448_to_string_cut_to_zero: [ OK ] 0.43 sec. 2026-03-09 10:26:10 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.42 sec. 2026-03-09 10:26:10 03003_compatibility_setting_bad_value: [ OK ] 0.37 sec. 2026-03-09 10:26:10 00981_in_subquery_with_tuple: [ OK ] 4.89 sec. 2026-03-09 10:26:11 02372_now_in_block: [ OK ] 1.47 sec. 2026-03-09 10:26:11 03208_uniq_with_empty_tuple: [ OK ] 0.42 sec. 2026-03-09 10:26:11 02160_h3_hex_area_Km2: [ OK ] 0.52 sec. 2026-03-09 10:26:11 02113_format_row: [ OK ] 0.47 sec. 2026-03-09 10:26:12 01384_bloom_filter_bad_arguments: [ OK ] 0.57 sec. 2026-03-09 10:26:13 01890_state_of_state: [ OK ] 0.78 sec. 2026-03-09 10:26:13 02006_client_test_hint_error_name: [ OK ] 0.42 sec. 2026-03-09 10:26:13 00612_pk_in_tuple_perf: [ OK ] 3.88 sec. 2026-03-09 10:26:13 02346_fulltext_index_search: [ OK ] 2.68 sec. 2026-03-09 10:26:13 01054_random_printable_ascii_ubsan: [ OK ] 3.48 sec. 2026-03-09 10:26:14 00310_tskv: [ OK ] 2.83 sec. 2026-03-09 10:26:14 03325_distributed_join_json_array_subcolumns: [ OK ] 0.57 sec. 2026-03-09 10:26:14 01323_if_with_nulls: [ OK ] 0.72 sec. 2026-03-09 10:26:14 02366_kql_mvexpand: [ OK ] 0.68 sec. 2026-03-09 10:26:14 02834_timestamp_function: [ OK ] 0.57 sec. 2026-03-09 10:26:14 02270_errors_in_files: [ OK ] 4.69 sec. 2026-03-09 10:26:14 03146_bug47862: [ OK ] 0.42 sec. 2026-03-09 10:26:14 01102_distributed_local_in_bug: [ OK ] 0.57 sec. 2026-03-09 10:26:15 02982_dont_infer_exponent_floats: [ OK ] 0.42 sec. 2026-03-09 10:26:15 02985_minmax_index_aggregate_function: [ OK ] 0.62 sec. 2026-03-09 10:26:15 00700_to_decimal_or_something_1: [ OK ] 1.63 sec. 2026-03-09 10:26:15 01825_new_type_json_12: [ OK ] 4.79 sec. 2026-03-09 10:26:15 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.47 sec. 2026-03-09 10:26:16 00975_recursive_materialized_view: [ OK ] 0.52 sec. 2026-03-09 10:26:16 00354_host_command_line_option: [ OK ] 2.13 sec. 2026-03-09 10:26:17 03290_final_collapsing: [ OK ] 0.57 sec. 2026-03-09 10:26:17 02456_test_zero_copy_mutation: [ OK ] 0.62 sec. 2026-03-09 10:26:18 02843_date_predicate_optimizations_bugs: [ OK ] 0.42 sec. 2026-03-09 10:26:18 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 2.78 sec. 2026-03-09 10:26:19 02377_modify_column_from_lc: [ OK ] 0.77 sec. 2026-03-09 10:26:19 02241_parquet_bad_column: [ OK ] 4.63 sec. 2026-03-09 10:26:20 02998_analyzer_secret_args_tree_node: [ OK ] 0.47 sec. 2026-03-09 10:26:20 00730_unicode_terminal_format: [ OK ] 0.52 sec. 2026-03-09 10:26:21 02242_throw_if_constant_argument: [ OK ] 0.42 sec. 2026-03-09 10:26:21 01514_input_format_json_enum_as_number: [ OK ] 0.47 sec. 2026-03-09 10:26:22 02023_storage_filelog: [ OK ] 7.39 sec. 2026-03-09 10:26:22 03313_case_insensitive_json_type_declaration: [ OK ] 0.37 sec. 2026-03-09 10:26:22 02021_prewhere_column_optimization: [ OK ] 0.47 sec. 2026-03-09 10:26:22 01782_field_oom: [ OK ] 4.73 sec. 2026-03-09 10:26:22 02377_optimize_sorting_by_input_stream_properties: [ OK ] 0.73 sec. 2026-03-09 10:26:23 02985_if_over_big_int_decimal: [ OK ] 0.52 sec. 2026-03-09 10:26:23 02316_values_table_func_bug: [ OK ] 0.42 sec. 2026-03-09 10:26:23 02240_get_type_serialization_streams: [ OK ] 0.47 sec. 2026-03-09 10:26:23 01621_sort_after_join_pipeline_stuck: [ OK ] 0.47 sec. 2026-03-09 10:26:23 01472_many_rows_in_totals: [ OK ] 0.47 sec. 2026-03-09 10:26:24 01710_projection_with_column_transformers: [ OK ] 0.42 sec. 2026-03-09 10:26:24 02421_simple_queries_for_opentelemetry: [ OK ] 7.44 sec. 2026-03-09 10:26:24 03038_ambiguous_column: [ OK ] 0.47 sec. 2026-03-09 10:26:25 02990_format_select_from_explain: [ OK ] 0.72 sec. 2026-03-09 10:26:25 02531_two_level_aggregation_bug: [ OK ] 1.83 sec. 2026-03-09 10:26:25 03144_invalid_filter: [ OK ] 0.52 sec. 2026-03-09 10:26:26 01684_insert_specify_shard_id: [ OK ] 0.72 sec. 2026-03-09 10:26:26 00280_hex_escape_sequence: [ OK ] 0.42 sec. 2026-03-09 10:26:26 01846_alter_column_without_type_bugfix: [ OK ] 0.32 sec. 2026-03-09 10:26:26 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.43 sec. 2026-03-09 10:26:26 02125_lz4_compression_bug_Values: [ OK ] 7.19 sec. 2026-03-09 10:26:26 00564_initial_column_values_with_default_expression: [ OK ] 0.47 sec. 2026-03-09 10:26:27 01101_literal_column_clash: [ OK ] 0.58 sec. 2026-03-09 10:26:27 02697_stop_reading_on_first_cancel: [ OK ] 2.18 sec. 2026-03-09 10:26:27 03230_anyHeavy_merge: [ OK ] 0.42 sec. 2026-03-09 10:26:27 00628_in_lambda_on_merge_table_bug: [ OK ] 0.57 sec. 2026-03-09 10:26:27 02966_nested_offsets_subcolumn: [ OK ] 1.02 sec. 2026-03-09 10:26:27 01079_alter_default_zookeeper_long: [ OK ] 0.77 sec. 2026-03-09 10:26:28 01881_create_as_tuple: [ OK ] 0.47 sec. 2026-03-09 10:26:28 00534_exp10: [ OK ] 0.47 sec. 2026-03-09 10:26:28 02358_file_default_value: [ OK ] 1.53 sec. 2026-03-09 10:26:28 02111_global_context_temporary_tables: [ OK ] 0.47 sec. 2026-03-09 10:26:28 01021_only_tuple_columns: [ OK ] 0.57 sec. 2026-03-09 10:26:29 01655_test_isnull_mysql_dialect: [ OK ] 0.43 sec. 2026-03-09 10:26:29 01519_topK_distributed_parametrized: [ OK ] 0.52 sec. 2026-03-09 10:26:29 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 5.63 sec. 2026-03-09 10:26:29 01070_string_to_h3: [ OK ] 0.43 sec. 2026-03-09 10:26:29 02703_jit_external_aggregation: [ SKIPPED ] 0.00 sec. 2026-03-09 10:26:29 Reason: not running for current build 2026-03-09 10:26:29 00521_multidimensional: [ OK ] 0.62 sec. 2026-03-09 10:26:29 02454_compressed_marks_in_compact_part: [ OK ] 0.57 sec. 2026-03-09 10:26:30 02317_distinct_in_order_optimization: [ OK ] 1.58 sec. 2026-03-09 10:26:30 02734_big_int_from_float_ubsan: [ OK ] 0.42 sec. 2026-03-09 10:26:31 02205_postgresql_functions: [ OK ] 1.17 sec. 2026-03-09 10:26:31 02112_delayed_clickhouse_local: [ OK ] 0.92 sec. 2026-03-09 10:26:31 03165_distinct_with_window_func_crash: [ OK ] 0.47 sec. 2026-03-09 10:26:32 02790_fix_coredump_when_compile_expression: [ OK ] 0.47 sec. 2026-03-09 10:26:32 02124_insert_deduplication_token_materialized_views: [ OK ] 2.23 sec. 2026-03-09 10:26:32 01923_different_expression_name_alias: [ OK ] 0.52 sec. 2026-03-09 10:26:33 03145_unicode_quotes: [ OK ] 0.47 sec. 2026-03-09 10:26:33 01131_max_rows_to_sort: [ OK ] 0.47 sec. 2026-03-09 10:26:33 01231_operator_null_in: [ OK ] 1.78 sec. 2026-03-09 10:26:35 02721_parquet_field_not_found: [ OK ] 1.07 sec. 2026-03-09 10:26:35 02245_s3_schema_desc: [ OK ] 0.62 sec. 2026-03-09 10:26:35 02246_is_secure_query_log: [ OK ] 5.79 sec. 2026-03-09 10:26:35 03215_grant_current_grants: [ OK ] 4.09 sec. 2026-03-09 10:26:36 02559_add_parts: [ OK ] 0.52 sec. 2026-03-09 10:26:36 02981_variant_type_function: [ OK ] 0.52 sec. 2026-03-09 10:26:36 02477_exists_fuzz_43478: [ OK ] 0.48 sec. 2026-03-09 10:26:36 01882_check_max_parts_to_merge_at_once: [ OK ] 1.02 sec. 2026-03-09 10:26:36 01505_pipeline_executor_UAF: [ OK ] 9.00 sec. 2026-03-09 10:26:37 00700_decimal_defaults: [ OK ] 0.47 sec. 2026-03-09 10:26:37 01071_in_array: [ OK ] 0.42 sec. 2026-03-09 10:26:37 02792_alter_table_modify_comment: [ OK ] 1.02 sec. 2026-03-09 10:26:37 00839_bitmask_negative: [ OK ] 0.47 sec. 2026-03-09 10:26:37 01739_index_hint: [ OK ] 0.68 sec. 2026-03-09 10:26:38 02898_parallel_replicas_custom_key_final: [ OK ] 0.52 sec. 2026-03-09 10:26:38 02316_cast_to_ip_address_default_column: [ OK ] 0.52 sec. 2026-03-09 10:26:38 00563_shard_insert_into_remote: [ OK ] 0.52 sec. 2026-03-09 10:26:39 01072_select_constant_limit: [ OK ] 0.37 sec. 2026-03-09 10:26:39 03246_json_tuple_decompress_race: [ OK ] 0.67 sec. 2026-03-09 10:26:39 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 5.79 sec. 2026-03-09 10:26:39 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.47 sec. 2026-03-09 10:26:39 03197_storage_join_strictness_type_restriction: [ OK ] 0.47 sec. 2026-03-09 10:26:39 01474_custom_null_tsv: [ OK ] 2.58 sec. 2026-03-09 10:26:39 02180_group_by_lowcardinality: [ OK ] 0.22 sec. 2026-03-09 10:26:40 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.47 sec. 2026-03-09 10:26:40 02974_if_with_map: [ OK ] 0.52 sec. 2026-03-09 10:26:40 01326_hostname_alias: [ OK ] 0.42 sec. 2026-03-09 10:26:40 01804_uniq_up_to_ubsan: [ OK ] 0.42 sec. 2026-03-09 10:26:40 02187_test_final_and_limit_modifier: [ OK ] 0.47 sec. 2026-03-09 10:26:40 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 0.42 sec. 2026-03-09 10:26:40 01496_signedness_conversion_monotonicity: [ OK ] 0.52 sec. 2026-03-09 10:26:40 00417_kill_query: [ OK ] 4.03 sec. 2026-03-09 10:26:40 01097_pre_limit: [ OK ] 0.42 sec. 2026-03-09 10:26:41 03038_move_partition_to_oneself_deadlock: [ OK ] 0.47 sec. 2026-03-09 10:26:41 01039_row_policy_dcl: [ OK ] 1.07 sec. 2026-03-09 10:26:42 02455_default_union_except_intersect: [ OK ] 0.77 sec. 2026-03-09 10:26:42 02953_slow_create_view: [ OK ] 0.47 sec. 2026-03-09 10:26:43 00506_union_distributed: [ OK ] 0.77 sec. 2026-03-09 10:26:43 03210_nested_short_circuit_functions_bug: [ OK ] 0.48 sec. 2026-03-09 10:26:44 01655_agg_if_nullable: [ OK ] 0.53 sec. 2026-03-09 10:26:44 01359_geodistance_loop: [ OK ] 0.53 sec. 2026-03-09 10:26:45 01651_lc_insert_tiny_log_2: [ OK ] 3.03 sec. 2026-03-09 10:26:46 02584_compressor_codecs: [ OK ] 1.38 sec. 2026-03-09 10:26:46 02356_insert_query_log_metrics: [ OK ] 0.82 sec. 2026-03-09 10:26:46 02560_analyzer_materialized_view: [ OK ] 0.58 sec. 2026-03-09 10:26:46 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 5.89 sec. 2026-03-09 10:26:46 00195_shard_union_all_and_global_in: [ OK ] 0.52 sec. 2026-03-09 10:26:47 00746_sql_fuzzy: [ OK ] 33.43 sec. 2026-03-09 10:26:47 03127_argMin_combinator_state: [ OK ] 0.47 sec. 2026-03-09 10:26:47 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.52 sec. 2026-03-09 10:26:47 01925_date_date_time_comparison: [ OK ] 0.47 sec. 2026-03-09 10:26:47 01425_decimal_parse_big_negative_exponent: [ OK ] 0.57 sec. 2026-03-09 10:26:47 03164_linestring_geometry: [ OK ] 0.42 sec. 2026-03-09 10:26:47 01188_attach_table_from_path: [ OK ] 0.57 sec. 2026-03-09 10:26:47 00392_enum_nested_alter: [ OK ] 0.82 sec. 2026-03-09 10:26:48 00284_external_aggregation_2: [ OK ] 7.05 sec. 2026-03-09 10:26:48 01474_decimal_scale_bug: [ OK ] 0.52 sec. 2026-03-09 10:26:48 01428_h3_range_check: [ OK ] 0.47 sec. 2026-03-09 10:26:48 03037_union_view: [ OK ] 0.47 sec. 2026-03-09 10:26:48 00626_replace_partition_from_table_zookeeper: [ OK ] 43.92 sec. 2026-03-09 10:26:48 03204_distributed_with_scalar_subquery: [ OK ] 0.47 sec. 2026-03-09 10:26:48 02503_in_lc_const_args_bug: [ OK ] 0.42 sec. 2026-03-09 10:26:49 00502_sum_map: [ OK ] 0.87 sec. 2026-03-09 10:26:49 00072_in_types: [ OK ] 0.42 sec. 2026-03-09 10:26:49 01710_query_log_with_projection_info: [ OK ] 1.02 sec. 2026-03-09 10:26:49 02188_table_function_format: [ OK ] 0.47 sec. 2026-03-09 10:26:50 00999_join_on_expression: [ OK ] 0.82 sec. 2026-03-09 10:26:50 03140_client_subsequent_external_tables: [ OK ] 1.18 sec. 2026-03-09 10:26:50 00842_array_with_constant_overflow: [ OK ] 0.42 sec. 2026-03-09 10:26:50 01831_max_streams: [ OK ] 0.42 sec. 2026-03-09 10:26:50 02325_compatibility_setting_2: [ OK ] 0.52 sec. 2026-03-09 10:26:50 02179_degrees_radians: [ OK ] 0.52 sec. 2026-03-09 10:26:51 00116_storage_set: [ OK ] 0.57 sec. 2026-03-09 10:26:51 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 0.42 sec. 2026-03-09 10:26:51 02366_kql_func_dynamic: [ OK ] 1.73 sec. 2026-03-09 10:26:51 03008_deduplication_wrong_mv: [ OK ] 0.52 sec. 2026-03-09 10:26:51 02946_literal_alias_misclassification: [ OK ] 0.52 sec. 2026-03-09 10:26:51 02834_array_exists_segfault: [ OK ] 0.43 sec. 2026-03-09 10:26:51 00701_join_default_strictness: [ OK ] 0.53 sec. 2026-03-09 10:26:52 02535_analyzer_limit_offset: [ OK ] 0.48 sec. 2026-03-09 10:26:52 03008_deduplication_insert_into_partitioned_table: [ OK ] 1.17 sec. 2026-03-09 10:26:52 01451_wrong_error_long_query: [ OK ] 0.77 sec. 2026-03-09 10:26:53 02526_kv_engine_different_filter_type: [ OK ] 0.62 sec. 2026-03-09 10:26:53 02789_reading_from_s3_with_connection_pool: [ OK ] 5.49 sec. 2026-03-09 10:26:53 02228_merge_tree_insert_memory_usage: [ OK ] 1.72 sec. 2026-03-09 10:26:54 03054_analyzer_join_alias: [ OK ] 0.42 sec. 2026-03-09 10:26:54 02301_harmful_reexec: [ OK ] 1.07 sec. 2026-03-09 10:26:54 00090_union_race_conditions_1: [ OK ] 14.43 sec. 2026-03-09 10:26:54 01273_arrow_dictionaries_load: [ OK ] 6.69 sec. 2026-03-09 10:26:54 00672_arrayDistinct: [ OK ] 0.52 sec. 2026-03-09 10:26:55 02579_parameterized_replace: [ OK ] 0.47 sec. 2026-03-09 10:26:55 00369_int_div_of_float: [ OK ] 0.42 sec. 2026-03-09 10:26:55 02949_ttl_group_by_bug: [ OK ] 0.57 sec. 2026-03-09 10:26:55 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ OK ] 2.13 sec. 2026-03-09 10:26:55 03156_nullable_number_tips: [ OK ] 0.52 sec. 2026-03-09 10:26:55 01701_clear_projection_and_part_remove: [ OK ] 0.62 sec. 2026-03-09 10:26:56 03046_column_in_block_array_join: [ OK ] 0.47 sec. 2026-03-09 10:26:56 00545_weird_aggregate_functions: [ OK ] 0.42 sec. 2026-03-09 10:26:56 01410_nullable_key_and_index_negate_cond: [ OK ] 0.63 sec. 2026-03-09 10:26:56 03018_external_with_complex_data_types: [ OK ] 1.18 sec. 2026-03-09 10:26:57 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 0.87 sec. 2026-03-09 10:26:57 03013_position_const_start_pos: [ OK ] 0.47 sec. 2026-03-09 10:26:57 02409_url_format_detection: [ OK ] 0.47 sec. 2026-03-09 10:26:57 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.52 sec. 2026-03-09 10:26:58 01783_merge_engine_join_key_condition: [ OK ] 0.62 sec. 2026-03-09 10:26:58 01508_query_obfuscator: [ OK ] 0.92 sec. 2026-03-09 10:26:58 01518_nullable_aggregate_states2: [ OK ] 3.78 sec. 2026-03-09 10:26:58 00169_join_constant_keys: [ OK ] 0.42 sec. 2026-03-09 10:26:58 01914_index_bgranvea: [ OK ] 0.47 sec. 2026-03-09 10:26:59 02346_into_outfile_and_stdout: [ OK ] 3.69 sec. 2026-03-09 10:26:59 03038_nested_dynamic_merges_small: [ OK ] 2.18 sec. 2026-03-09 10:26:59 02968_mysql_prefer_column_name_to_alias: [ OK ] 0.82 sec. 2026-03-09 10:26:59 01710_minmax_count_projection_modify_partition_key: [ OK ] 0.47 sec. 2026-03-09 10:26:59 00902_entropy: [ OK ] 0.58 sec. 2026-03-09 10:26:59 00054_join_string: [ OK ] 0.52 sec. 2026-03-09 10:27:00 02316_const_string_intersact: [ OK ] 0.42 sec. 2026-03-09 10:27:00 03287_dynamic_and_json_squashing_fix: [ OK ] 0.62 sec. 2026-03-09 10:27:00 03261_sort_cursor_crash: [ OK ] 0.57 sec. 2026-03-09 10:27:02 02784_parallel_replicas_automatic_decision: [ OK ] 10.61 sec. 2026-03-09 10:27:02 01079_order_by_pk: [ OK ] 3.63 sec. 2026-03-09 10:27:02 03172_http_content_encoding: [ OK ] 2.37 sec. 2026-03-09 10:27:02 00590_limit_by_column_removal: [ OK ] 0.48 sec. 2026-03-09 10:27:03 00098_shard_i_union_all: [ OK ] 0.62 sec. 2026-03-09 10:27:03 02737_sql_auto_is_null: [ OK ] 0.43 sec. 2026-03-09 10:27:03 01710_force_use_projection: [ OK ] 0.58 sec. 2026-03-09 10:27:03 02422_read_numbers_as_strings: [ OK ] 0.42 sec. 2026-03-09 10:27:04 00661_array_has_silviucpp: [ OK ] 0.47 sec. 2026-03-09 10:27:04 03065_analyzer_cross_join_and_array_join: [ OK ] 0.42 sec. 2026-03-09 10:27:04 03262_udf_in_constraint: [ OK ] 1.27 sec. 2026-03-09 10:27:05 02008_materialize_column: [ OK ] 0.82 sec. 2026-03-09 10:27:05 01137_sample_final: [ OK ] 0.52 sec. 2026-03-09 10:27:06 02901_remove_nullable_crash_analyzer: [ OK ] 0.47 sec. 2026-03-09 10:27:06 00746_compile_non_deterministic_function: [ OK ] 6.55 sec. 2026-03-09 10:27:06 02151_hash_table_sizes_stats_distributed: [ SKIPPED ] 0.00 sec. 2026-03-09 10:27:06 Reason: not running for current build 2026-03-09 10:27:06 02524_fuzz_and_fuss: [ OK ] 0.42 sec. 2026-03-09 10:27:06 00540_bad_data_types: [ OK ] 7.10 sec. 2026-03-09 10:27:06 01121_remote_scalar_subquery: [ OK ] 0.47 sec. 2026-03-09 10:27:06 00464_array_element_out_of_range: [ OK ] 0.42 sec. 2026-03-09 10:27:06 02464_decimal_scale_buffer_overflow: [ OK ] 0.47 sec. 2026-03-09 10:27:07 00745_compile_scalar_subquery: [ OK ] 0.52 sec. 2026-03-09 10:27:07 01529_bad_memory_tracking: [ OK ] 4.64 sec. 2026-03-09 10:27:08 01719_join_timezone: [ OK ] 0.57 sec. 2026-03-09 10:27:08 01523_client_local_queries_file_parameter: [ OK ] 2.63 sec. 2026-03-09 10:27:08 01769_extended_range_2: [ OK ] 0.52 sec. 2026-03-09 10:27:08 01906_bigint_accurate_cast_ubsan: [ OK ] 0.72 sec. 2026-03-09 10:27:08 01034_move_partition_from_table_zookeeper: [ OK ] 53.04 sec. 2026-03-09 10:27:09 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 2.14 sec. 2026-03-09 10:27:09 00559_filter_array_generic: [ OK ] 0.42 sec. 2026-03-09 10:27:09 02560_count_digits: [ OK ] 0.52 sec. 2026-03-09 10:27:09 02368_analyzer_table_functions: [ OK ] 0.47 sec. 2026-03-09 10:27:09 02994_inconsistent_formatting: [ OK ] 0.47 sec. 2026-03-09 10:27:09 02680_default_star: [ OK ] 0.42 sec. 2026-03-09 10:27:10 00740_optimize_predicate_expression: [ OK ] 0.47 sec. 2026-03-09 10:27:10 03034_recursive_cte_tree: [ OK ] 0.62 sec. 2026-03-09 10:27:10 02475_analyzer_join_tree_subquery: [ OK ] 0.47 sec. 2026-03-09 10:27:10 00804_test_custom_compression_codes_log_storages: [ OK ] 0.98 sec. 2026-03-09 10:27:11 01518_cast_nullable_virtual_system_column: [ OK ] 0.47 sec. 2026-03-09 10:27:11 00098_6_union_all: [ OK ] 0.47 sec. 2026-03-09 10:27:11 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 0.57 sec. 2026-03-09 10:27:11 02998_projection_after_attach_partition: [ OK ] 0.62 sec. 2026-03-09 10:27:11 02705_settings_check_changed_flag: [ OK ] 0.77 sec. 2026-03-09 10:27:13 02595_orc_arrow_parquet_more_types: [ OK ] 1.77 sec. 2026-03-09 10:27:13 02562_native_tskv_default_for_omitted_fields: [ OK ] 6.64 sec. 2026-03-09 10:27:14 01063_create_column_set: [ OK ] 0.42 sec. 2026-03-09 10:27:14 00625_arrays_in_nested: [ OK ] 0.67 sec. 2026-03-09 10:27:14 02561_temporary_table_grants: [ OK ] 7.54 sec. 2026-03-09 10:27:14 02918_multif_for_nullable: [ OK ] 2.68 sec. 2026-03-09 10:27:14 02475_or_function_alias_and_const_where: [ OK ] 0.47 sec. 2026-03-09 10:27:14 02389_analyzer_nested_lambda: [ OK ] 5.99 sec. 2026-03-09 10:27:14 01413_if_array_uuid: [ OK ] 0.42 sec. 2026-03-09 10:27:15 02313_cross_join_dup_col_names: [ OK ] 0.47 sec. 2026-03-09 10:27:15 02500_bson_read_object_id: [ OK ] 1.02 sec. 2026-03-09 10:27:15 01622_constraints_simple_optimization: [ OK ] 1.23 sec. 2026-03-09 10:27:16 03093_reading_bug_with_parallel_replicas: [ OK ] 0.82 sec. 2026-03-09 10:27:16 00743_limit_by_not_found_column: [ OK ] 0.57 sec. 2026-03-09 10:27:16 00534_functions_bad_arguments11: [ SKIPPED ] 0.00 sec. 2026-03-09 10:27:16 Reason: not running for current build 2026-03-09 10:27:16 02481_i43247_ubsan_in_minmaxany: [ OK ] 1.82 sec. 2026-03-09 10:27:16 03210_optimize_rewrite_aggregate_function_with_if_return_type_bug: [ OK ] 0.57 sec. 2026-03-09 10:27:16 01527_materialized_view_stack_overflow: [ OK ] 1.73 sec. 2026-03-09 10:27:17 00917_multiple_joins_denny_crane: [ OK ] 0.52 sec. 2026-03-09 10:27:17 02367_analyzer_table_alias_columns: [ OK ] 0.57 sec. 2026-03-09 10:27:17 02565_update_empty_nested: [ OK ] 0.58 sec. 2026-03-09 10:27:17 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 0.52 sec. 2026-03-09 10:27:18 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 1.12 sec. 2026-03-09 10:27:18 01017_bithamming_distance: [ OK ] 0.52 sec. 2026-03-09 10:27:18 02176_dict_get_has_implicit_key_cast: [ OK ] 0.77 sec. 2026-03-09 10:27:18 03156_default_multiquery_split: [ OK ] 1.58 sec. 2026-03-09 10:27:18 01610_client_spawn_editor: [ OK ] 0.17 sec. 2026-03-09 10:27:18 02280_add_query_level_settings: [ OK ] 0.62 sec. 2026-03-09 10:27:18 02686_bson3: [ OK ] 0.47 sec. 2026-03-09 10:27:19 00271_agg_state_and_totals: [ OK ] 0.47 sec. 2026-03-09 10:27:19 03203_system_numbers_limit_and_offset_complex: [ OK ] 0.62 sec. 2026-03-09 10:27:19 02152_dictionary_date32_type: [ OK ] 0.52 sec. 2026-03-09 10:27:19 00041_big_array_join: [ OK ] 0.58 sec. 2026-03-09 10:27:20 03164_adapting_parquet_reader_output_size: [ OK ] 1.37 sec. 2026-03-09 10:27:20 00952_part_frozen_info: [ OK ] 0.57 sec. 2026-03-09 10:27:20 01170_alter_partition_isolation: [ OK ] 5.74 sec. 2026-03-09 10:27:20 02950_parallel_replicas_used_count: [ OK ] 1.98 sec. 2026-03-09 10:27:20 01802_formatDateTime_DateTime64_century: [ OK ] 0.52 sec. 2026-03-09 10:27:21 01461_query_start_time_microseconds: [ OK ] 0.92 sec. 2026-03-09 10:27:21 01277_fromUnixTimestamp64: [ OK ] 0.57 sec. 2026-03-09 10:27:21 03261_test_merge_parquet_bloom_filter_minmax_stats: [ OK ] 1.73 sec. 2026-03-09 10:27:21 02155_parse_date_lowcard_default_throw: [ OK ] 0.42 sec. 2026-03-09 10:27:22 01272_totals_and_filter_bug: [ OK ] 0.63 sec. 2026-03-09 10:27:22 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.53 sec. 2026-03-09 10:27:22 02793_implicit_pretty_format_settings: [ OK ] 1.22 sec. 2026-03-09 10:27:22 02903_client_insert_in_background: [ OK ] 2.18 sec. 2026-03-09 10:27:23 00370_duplicate_columns_in_subqueries: [ OK ] 0.58 sec. 2026-03-09 10:27:23 00938_test_retention_function: [ OK ] 0.52 sec. 2026-03-09 10:27:23 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 22.60 sec. 2026-03-09 10:27:23 02354_vector_search_default_granularity: [ OK ] 0.53 sec. 2026-03-09 10:27:23 01339_client_unrecognized_option: [ OK ] 1.13 sec. 2026-03-09 10:27:23 01621_bar_nan_arguments: [ OK ] 0.42 sec. 2026-03-09 10:27:24 03262_test_parquet_native_reader_int_logical_type: [ OK ] 1.73 sec. 2026-03-09 10:27:24 03215_toStartOfWeek_with_dateTime64_fix: [ OK ] 0.42 sec. 2026-03-09 10:27:24 02359_send_logs_source_regexp: [ OK ] 1.07 sec. 2026-03-09 10:27:24 01047_no_alias_columns_with_table_aliases: [ OK ] 0.47 sec. 2026-03-09 10:27:24 02809_has_token: [ OK ] 0.47 sec. 2026-03-09 10:27:24 00073_merge_sorting_empty_array_joined: [ OK ] 0.42 sec. 2026-03-09 10:27:24 02131_materialize_column_cast: [ OK ] 0.64 sec. 2026-03-09 10:27:24 01031_pmj_new_any_semi_join: [ OK ] 0.62 sec. 2026-03-09 10:27:24 00267_tuple_array_access_operators_priority: [ OK ] 0.52 sec. 2026-03-09 10:27:25 00763_long_lock_buffer_alter_destination_table: [ OK ] 32.73 sec. 2026-03-09 10:27:25 01330_array_join_in_higher_order_function: [ OK ] 0.42 sec. 2026-03-09 10:27:25 02535_ip_parser_not_whole: [ OK ] 0.47 sec. 2026-03-09 10:27:25 01062_pm_multiple_all_join_same_value: [ OK ] 0.42 sec. 2026-03-09 10:27:25 02517_uuid_parsing: [ OK ] 0.52 sec. 2026-03-09 10:27:26 02999_analyzer_preimage_null: [ OK ] 0.47 sec. 2026-03-09 10:27:26 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.47 sec. 2026-03-09 10:27:26 00265_http_content_type_format_timezone: [ OK ] 1.42 sec. 2026-03-09 10:27:26 02016_summing_mt_aggregating_column: [ OK ] 0.52 sec. 2026-03-09 10:27:26 03215_varian_as_common_type_tuple_map: [ OK ] 0.47 sec. 2026-03-09 10:27:26 02428_delete_with_settings: [ OK ] 0.67 sec. 2026-03-09 10:27:27 02693_multiple_joins_in: [ OK ] 0.42 sec. 2026-03-09 10:27:27 01714_alter_drop_version: [ OK ] 0.52 sec. 2026-03-09 10:27:27 03131_rewrite_sum_if_nullable: [ OK ] 0.62 sec. 2026-03-09 10:27:27 00688_low_cardinality_serialization: [ OK ] 2.98 sec. 2026-03-09 10:27:27 02933_sqid: [ OK ] 2.83 sec. 2026-03-09 10:27:27 02008_test_union_distinct_in_subquery: [ OK ] 0.62 sec. 2026-03-09 10:27:28 00199_ternary_operator_type_check: [ OK ] 0.87 sec. 2026-03-09 10:27:28 02181_dictionary_attach_detach: [ OK ] 0.57 sec. 2026-03-09 10:27:28 02150_index_hypothesis_race_long: [ OK ] 7.60 sec. 2026-03-09 10:27:28 02534_join_prewhere_bug: [ OK ] 0.59 sec. 2026-03-09 10:27:28 00114_float_type_result_of_division: [ OK ] 0.42 sec. 2026-03-09 10:27:28 00191_aggregating_merge_tree_and_final: [ OK ] 0.52 sec. 2026-03-09 10:27:28 01925_jit_aggregation_function_count_long: [ OK ] 0.57 sec. 2026-03-09 10:27:28 01522_validate_alter_default: [ OK ] 0.47 sec. 2026-03-09 10:27:28 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 0.62 sec. 2026-03-09 10:27:28 00779_all_right_join_max_block_size: [ OK ] 0.52 sec. 2026-03-09 10:27:28 01376_array_fill_empty: [ OK ] 0.47 sec. 2026-03-09 10:27:29 01281_parseDateTime64BestEffort: [ OK ] 0.92 sec. 2026-03-09 10:27:29 02458_key_condition_not_like_prefix: [ OK ] 0.57 sec. 2026-03-09 10:27:29 02540_duplicate_primary_key2: [ OK ] 0.47 sec. 2026-03-09 10:27:29 01284_view_and_extremes_bug: [ OK ] 0.42 sec. 2026-03-09 10:27:29 02132_client_history_navigation: [ OK ] 1.17 sec. 2026-03-09 10:27:29 01802_toDateTime64_large_values: [ OK ] 0.52 sec. 2026-03-09 10:27:30 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.67 sec. 2026-03-09 10:27:30 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 0.58 sec. 2026-03-09 10:27:30 02724_mutliple_storage_join: [ OK ] 0.52 sec. 2026-03-09 10:27:30 00709_virtual_column_partition_id: [ OK ] 0.58 sec. 2026-03-09 10:27:31 02158_ztest_cmp: [ OK ] 2.48 sec. 2026-03-09 10:27:31 02479_if_with_null_and_cullable_const: [ OK ] 0.47 sec. 2026-03-09 10:27:31 02136_scalar_read_rows_json: [ OK ] 1.57 sec. 2026-03-09 10:27:31 02968_analyzer_join_column_not_found: [ OK ] 0.49 sec. 2026-03-09 10:27:32 01451_detach_drop_part: [ OK ] 0.62 sec. 2026-03-09 10:27:32 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 2.19 sec. 2026-03-09 10:27:32 01526_initial_query_id: [ OK ] 2.44 sec. 2026-03-09 10:27:33 02783_parsedatetimebesteffort_syslog: [ OK ] 0.48 sec. 2026-03-09 10:27:33 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.43 sec. 2026-03-09 10:27:33 02907_fromDaysSinceYearZero: [ OK ] 0.82 sec. 2026-03-09 10:27:34 01107_tuples_arrays_parsing_exceptions: [ OK ] 1.37 sec. 2026-03-09 10:27:34 01456_low_cardinality_sorting_bugfix: [ OK ] 0.53 sec. 2026-03-09 10:27:34 03020_output_format_client: [ OK ] 3.08 sec. 2026-03-09 10:27:34 00685_output_format_json_escape_forward_slashes: [ OK ] 0.43 sec. 2026-03-09 10:27:35 01702_system_numbers_scientific_notation: [ OK ] 0.62 sec. 2026-03-09 10:27:35 01958_partial_hour_timezone: [ OK ] 0.47 sec. 2026-03-09 10:27:36 02456_async_inserts_logs: [ OK ] 4.94 sec. 2026-03-09 10:27:36 01533_distinct_depends_on_max_threads: [ OK ] 0.88 sec. 2026-03-09 10:27:36 02115_write_buffers_finalize: [ OK ] 12.72 sec. 2026-03-09 10:27:37 02477_age: [ OK ] 0.83 sec. 2026-03-09 10:27:37 02963_test_flexible_disk_configuration: [ OK ] 1.28 sec. 2026-03-09 10:27:37 02155_nested_lc_defalut_bug: [ OK ] 0.48 sec. 2026-03-09 10:27:38 02009_array_join_partition: [ OK ] 0.48 sec. 2026-03-09 10:27:38 02499_escaped_quote_schema_inference: [ OK ] 0.53 sec. 2026-03-09 10:27:38 02907_backup_restore_flatten_nested: [ OK ] 3.83 sec. 2026-03-09 10:27:39 00700_decimal_in_keys: [ OK ] 0.67 sec. 2026-03-09 10:27:39 03447_grouping_sets_analyzer_const_columns: [ OK ] 0.57 sec. 2026-03-09 10:27:39 01720_country_perimeter_and_area: [ OK ] 7.15 sec. 2026-03-09 10:27:39 01024__getScalar: [ OK ] 0.47 sec. 2026-03-09 10:27:40 02724_function_in_left_table_clause_asof_join: [ OK ] 0.47 sec. 2026-03-09 10:27:40 01780_column_sparse_full: [ OK ] 1.14 sec. 2026-03-09 10:27:40 03158_dynamic_type_from_variant: [ OK ] 0.47 sec. 2026-03-09 10:27:40 00209_insert_select_extremes: [ OK ] 0.53 sec. 2026-03-09 10:27:41 02811_csv_input_field_type_mismatch: [ OK ] 2.73 sec. 2026-03-09 10:27:41 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 0.53 sec. 2026-03-09 10:27:41 02426_to_string_nullable_fixedstring: [ OK ] 0.52 sec. 2026-03-09 10:27:41 01492_array_join_crash_13829: [ OK ] 0.42 sec. 2026-03-09 10:27:41 01685_ssd_cache_dictionary_complex_key: [ OK ] 1.53 sec. 2026-03-09 10:27:42 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 5.36 sec. 2026-03-09 10:27:42 02030_client_unknown_database: [ OK ] 1.13 sec. 2026-03-09 10:27:43 03208_buffer_over_distributed_type_mismatch: [ OK ] 1.13 sec. 2026-03-09 10:27:43 02255_broken_parts_chain_on_start: [ OK ] 8.86 sec. 2026-03-09 10:27:43 01039_mergetree_exec_time: [ OK ] 1.53 sec. 2026-03-09 10:27:43 00623_replicated_truncate_table_zookeeper_long: [ OK ] 0.68 sec. 2026-03-09 10:27:43 01277_large_tuples: [ OK ] 0.48 sec. 2026-03-09 10:27:43 02133_distributed_queries_formatting: [ OK ] 0.43 sec. 2026-03-09 10:27:44 02972_parallel_replicas_cte: [ OK ] 0.72 sec. 2026-03-09 10:27:44 02797_range_nullable: [ OK ] 0.53 sec. 2026-03-09 10:27:44 02971_functions_to_subcolumns_variant: [ OK ] 0.47 sec. 2026-03-09 10:27:44 02842_one_input_format: [ OK ] 2.74 sec. 2026-03-09 10:27:44 02479_analyzer_aggregation_crash: [ OK ] 0.63 sec. 2026-03-09 10:27:44 00534_functions_bad_arguments7: [ SKIPPED ] 0.00 sec. 2026-03-09 10:27:44 Reason: not running for current build 2026-03-09 10:27:44 00746_hashing_tuples: [ OK ] 0.52 sec. 2026-03-09 10:27:44 02220_array_join_format: [ OK ] 0.47 sec. 2026-03-09 10:27:44 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.52 sec. 2026-03-09 10:27:45 01710_minmax_count_projection_distributed_query: [ OK ] 0.48 sec. 2026-03-09 10:27:45 01424_parse_date_time_bad_date: [ OK ] 0.52 sec. 2026-03-09 10:27:45 01274_generate_random_nested: [ OK ] 0.72 sec. 2026-03-09 10:27:45 03143_join_filter_push_down_filled_join_fix: [ OK ] 0.52 sec. 2026-03-09 10:27:46 02342_window_view_different_struct: [ OK ] 0.67 sec. 2026-03-09 10:27:46 02457_tuple_of_intervals: [ OK ] 0.82 sec. 2026-03-09 10:27:46 01458_named_tuple_millin: [ OK ] 0.42 sec. 2026-03-09 10:27:47 00041_aggregation_remap: [ OK ] 0.52 sec. 2026-03-09 10:27:47 02895_peak_memory_usage_http_headers_regression: [ OK ] 1.22 sec. 2026-03-09 10:27:47 02122_parallel_formatting_JSONEachRow: [ OK ] 3.58 sec. 2026-03-09 10:27:47 02490_replacing_merge_tree_is_deleted_column: [ OK ] 1.67 sec. 2026-03-09 10:27:47 02232_partition_pruner_mixed_constant_type: [ OK ] 0.52 sec. 2026-03-09 10:27:47 03211_nested_json_merges: [ OK ] 36.86 sec. 2026-03-09 10:27:48 01386_negative_float_constant_key_condition: [ OK ] 0.47 sec. 2026-03-09 10:27:48 00177_inserts_through_http_parts: [ OK ] 0.87 sec. 2026-03-09 10:27:48 00957_delta_diff_bug: [ OK ] 0.47 sec. 2026-03-09 10:27:48 02122_4letter_words_stress_zookeeper: [ OK ] 19.91 sec. 2026-03-09 10:27:48 02943_order_by_all: [ OK ] 0.77 sec. 2026-03-09 10:27:49 03057_analyzer_subquery_alias_join: [ OK ] 0.87 sec. 2026-03-09 10:27:51 01550_create_map_type: [ OK ] 2.39 sec. 2026-03-09 10:27:53 02151_http_s_structure_set_eof: [ OK ] 4.94 sec. 2026-03-09 10:27:53 02296_nullable_arguments_in_array_filter: [ OK ] 1.55 sec. 2026-03-09 10:27:55 00803_odbc_driver_2_format: [ OK ] 1.90 sec. 2026-03-09 10:27:55 02461_mullable_pk_monotonicity_bug: [ OK ] 2.72 sec. 2026-03-09 10:27:56 02474_fix_function_parser_bug: [ OK ] 1.49 sec. 2026-03-09 10:27:58 03152_dynamic_type_simple: [ OK ] 2.20 sec. 2026-03-09 10:27:59 01259_dictionary_custom_settings_ddl: [ OK ] 2.46 sec. 2026-03-09 10:28:01 02326_numbers_from_json_strings_schema_inference: [ OK ] 1.77 sec. 2026-03-09 10:28:11 01058_window_view_event_hop_to_strict_asc: [ OK ] 12.61 sec. 2026-03-09 10:28:12 02994_sanity_check_settings: [ OK ] 1.52 sec. 2026-03-09 10:28:13 02883_zookeeper_finalize_stress: [ OK ] 24.00 sec. 2026-03-09 10:28:14 02785_left_anti_join_bug: [ OK ] 1.31 sec. 2026-03-09 10:28:14 03095_msan_uuid_string_to_num: [ OK ] 1.49 sec. 2026-03-09 10:28:15 01156_pcg_deserialization: [ OK ] 34.77 sec. 2026-03-09 10:28:16 01470_explain: [ OK ] 1.70 sec. 2026-03-09 10:28:16 02128_apply_lambda_parsing: [ OK ] 1.65 sec. 2026-03-09 10:28:17 00476_pretty_formats_and_widths: [ OK ] 1.25 sec. 2026-03-09 10:28:18 03154_recursive_cte_distributed: [ OK ] 1.99 sec. 2026-03-09 10:28:18 02461_cancel_finish_race: [ OK ] 30.84 sec. 2026-03-09 10:28:19 01399_http_request_headers: [ OK ] 3.64 sec. 2026-03-09 10:28:19 01186_conversion_to_nullable: [ OK ] 0.53 sec. 2026-03-09 10:28:19 00991_system_parts_race_condition_long: [ OK ] 32.19 sec. 2026-03-09 10:28:19 01560_crash_in_agg_empty_arglist: [ OK ] 0.88 sec. 2026-03-09 10:28:19 01071_force_optimize_skip_unused_shards: [ OK ] 1.29 sec. 2026-03-09 10:28:19 01913_fix_column_transformer_replace_format: [ OK ] 0.37 sec. 2026-03-09 10:28:20 02426_pod_array_overflow_2: [ OK ] 0.42 sec. 2026-03-09 10:28:20 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 0.53 sec. 2026-03-09 10:28:20 03022_alter_materialized_view_query_has_inner_table: [ OK ] 0.57 sec. 2026-03-09 10:28:20 02125_fix_storage_filelog: [ OK ] 0.47 sec. 2026-03-09 10:28:20 02956_fix_to_start_of_milli_microsecond: [ OK ] 0.47 sec. 2026-03-09 10:28:20 01821_to_date_time_ubsan: [ OK ] 0.42 sec. 2026-03-09 10:28:21 02100_multiple_hosts_command_line_set_ssl: [ OK ] 36.11 sec. 2026-03-09 10:28:21 01902_table_function_merge_db_params: [ OK ] 0.53 sec. 2026-03-09 10:28:21 00739_array_element_nullable_string_mattrobenolt: [ OK ] 0.52 sec. 2026-03-09 10:28:21 01923_ttl_with_modify_column: [ OK ] 0.67 sec. 2026-03-09 10:28:21 00552_logical_functions_uint8_as_bool: [ OK ] 0.47 sec. 2026-03-09 10:28:22 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 0.67 sec. 2026-03-09 10:28:22 00974_adaptive_granularity_secondary_index: [ OK ] 1.43 sec. 2026-03-09 10:28:22 01018_ddl_dictionaries_special: [ OK ] 0.78 sec. 2026-03-09 10:28:22 01601_proxy_protocol: [ OK ] 0.77 sec. 2026-03-09 10:28:22 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.47 sec. 2026-03-09 10:28:23 02918_optimize_count_for_merge_tables: [ OK ] 0.58 sec. 2026-03-09 10:28:23 00950_test_gorilla_codec: [ OK ] 0.77 sec. 2026-03-09 10:28:23 00064_negate_bug: [ OK ] 0.42 sec. 2026-03-09 10:28:23 02800_transform_alter: [ OK ] 0.57 sec. 2026-03-09 10:28:23 01528_clickhouse_local_prepare_parts: [ OK ] 3.99 sec. 2026-03-09 10:28:24 03284_json_object_as_tuple_duplicate_keys: [ OK ] 0.53 sec. 2026-03-09 10:28:24 01214_point_in_Mecca: [ OK ] 1.68 sec. 2026-03-09 10:28:24 00862_decimal_in: [ OK ] 0.62 sec. 2026-03-09 10:28:24 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.47 sec. 2026-03-09 10:28:24 02212_h3_get_pentagon_indexes: [ OK ] 0.62 sec. 2026-03-09 10:28:25 01906_partition_by_multiply_by_zero: [ OK ] 0.48 sec. 2026-03-09 10:28:25 01013_hex_float: [ OK ] 0.63 sec. 2026-03-09 10:28:25 02174_cte_scalar_cache: [ OK ] 0.98 sec. 2026-03-09 10:28:25 01889_check_row_policy_defined_using_user_function: [ OK ] 8.23 sec. 2026-03-09 10:28:25 00989_parallel_parts_loading: [ OK ] 3.18 sec. 2026-03-09 10:28:26 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 1.98 sec. 2026-03-09 10:28:26 00823_capnproto_input: [ OK ] 2.83 sec. 2026-03-09 10:28:26 01416_clear_column_pk: [ OK ] 0.58 sec. 2026-03-09 10:28:26 01787_map_remote: [ OK ] 0.57 sec. 2026-03-09 10:28:26 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 0.62 sec. 2026-03-09 10:28:26 02031_format_query_option: [ OK ] 0.82 sec. 2026-03-09 10:28:27 02113_untuple_func_alias: [ OK ] 0.42 sec. 2026-03-09 10:28:27 01851_clear_column_referenced_by_mv: [ OK ] 0.47 sec. 2026-03-09 10:28:27 00804_test_custom_compression_codecs: [ OK ] 1.07 sec. 2026-03-09 10:28:27 02871_clickhouse_client_restart_pager: [ OK ] 1.12 sec. 2026-03-09 10:28:28 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 0.62 sec. 2026-03-09 10:28:28 00712_nan_comparison: [ OK ] 0.72 sec. 2026-03-09 10:28:28 02466_distributed_query_profiler: [ OK ] 1.37 sec. 2026-03-09 10:28:28 00551_parse_or_null: [ OK ] 0.42 sec. 2026-03-09 10:28:29 00653_monotonic_integer_cast: [ OK ] 0.42 sec. 2026-03-09 10:28:29 02862_sorted_distinct_sparse_fix: [ OK ] 0.52 sec. 2026-03-09 10:28:29 03200_subcolumns_join_use_nulls: [ OK ] 0.47 sec. 2026-03-09 10:28:29 01504_rocksdb: [ OK ] 2.58 sec. 2026-03-09 10:28:29 01430_fix_any_rewrite_aliases: [ OK ] 0.42 sec. 2026-03-09 10:28:30 02886_binary_like: [ OK ] 0.52 sec. 2026-03-09 10:28:30 00061_merge_tree_alter: [ OK ] 0.82 sec. 2026-03-09 10:28:31 01272_offset_without_limit: [ OK ] 0.47 sec. 2026-03-09 10:28:31 02274_full_sort_join_nodistinct: [ OK ] 5.94 sec. 2026-03-09 10:28:32 02900_issue_55858: [ OK ] 0.62 sec. 2026-03-09 10:28:32 02803_backup_tmp_files: [ OK ] 2.28 sec. 2026-03-09 10:28:32 00331_final_and_prewhere: [ OK ] 0.57 sec. 2026-03-09 10:28:32 02456_alter-nullable-column-bag: [ OK ] 0.52 sec. 2026-03-09 10:28:33 00239_type_conversion_in_in: [ OK ] 0.48 sec. 2026-03-09 10:28:33 03217_fliter_pushdown_no_keys: [ OK ] 0.52 sec. 2026-03-09 10:28:33 01880_materialized_view_to_table_type_check: [ OK ] 0.62 sec. 2026-03-09 10:28:34 01246_extractAllGroupsVertical: [ OK ] 0.67 sec. 2026-03-09 10:28:35 01353_low_cardinality_join_types: [ OK ] 0.88 sec. 2026-03-09 10:28:35 01441_array_combinator: [ OK ] 0.47 sec. 2026-03-09 10:28:36 01040_dictionary_invalidate_query_switchover_long: [ OK ] 9.95 sec. 2026-03-09 10:28:37 02947_dropped_tables_parts: [ OK ] 0.57 sec. 2026-03-09 10:28:37 01415_sticking_mutations: [ OK ] 47.67 sec. 2026-03-09 10:28:37 00098_a_union_all: [ OK ] 0.42 sec. 2026-03-09 10:28:37 00627_recursive_alias: [ OK ] 0.42 sec. 2026-03-09 10:28:38 00341_squashing_insert_select2: [ OK ] 0.67 sec. 2026-03-09 10:28:38 02021_exponential_sum_shard: [ OK ] 1.07 sec. 2026-03-09 10:28:39 02225_hints_for_indeices: [ OK ] 3.28 sec. 2026-03-09 10:28:39 02110_clickhouse_local_custom_tld: [ OK ] 0.97 sec. 2026-03-09 10:28:39 02243_make_date32_mysql: [ OK ] 0.62 sec. 2026-03-09 10:28:39 02233_HTTP_ranged: [ OK ] 1.48 sec. 2026-03-09 10:28:40 02189_join_type_conversion: [ OK ] 0.42 sec. 2026-03-09 10:28:40 02813_func_today_and_alias: [ OK ] 0.47 sec. 2026-03-09 10:28:40 02177_sum_if_not_found: [ OK ] 0.68 sec. 2026-03-09 10:28:40 01062_pm_all_join_with_block_continuation: [ OK ] 10.91 sec. 2026-03-09 10:28:41 01051_new_any_join_engine: [ OK ] 0.72 sec. 2026-03-09 10:28:41 02013_json_function_null_column: [ OK ] 0.77 sec. 2026-03-09 10:28:41 03352_distinct_sorted_bug: [ OK ] 0.48 sec. 2026-03-09 10:28:42 02378_part_log_profile_events: [ OK ] 1.18 sec. 2026-03-09 10:28:42 00483_reading_from_array_structure: [ OK ] 0.54 sec. 2026-03-09 10:28:42 02790_async_queries_in_query_log: [ OK ] 9.65 sec. 2026-03-09 10:28:43 02223_h3_test_const_columns: [ OK ] 0.67 sec. 2026-03-09 10:28:43 00857_global_joinsavel_table_alias: [ OK ] 0.73 sec. 2026-03-09 10:28:43 01470_test_insert_select_asterisk: [ OK ] 0.57 sec. 2026-03-09 10:28:43 03039_dynamic_collapsing_merge_tree: [ OK ] 15.47 sec. 2026-03-09 10:28:44 01942_dateTimeToSnowflakeID: [ OK ] 0.77 sec. 2026-03-09 10:28:44 01014_format_custom_separated: [ OK ] 4.29 sec. 2026-03-09 10:28:44 00434_tonullable: [ OK ] 0.48 sec. 2026-03-09 10:28:44 02813_float_parsing: [ OK ] 0.47 sec. 2026-03-09 10:28:44 02181_format_describe_query: [ OK ] 0.97 sec. 2026-03-09 10:28:44 02771_ignore_data_skipping_indices: [ OK ] 0.67 sec. 2026-03-09 10:28:45 02725_any_join_single_row: [ OK ] 0.68 sec. 2026-03-09 10:28:45 00467_qualified_names: [ OK ] 0.62 sec. 2026-03-09 10:28:46 02908_Npy_files_caching: [ OK ] 2.18 sec. 2026-03-09 10:28:46 02417_null_variadic_behaviour: [ OK ] 1.12 sec. 2026-03-09 10:28:47 01356_state_resample: [ OK ] 0.52 sec. 2026-03-09 10:28:47 02469_interval_msan: [ OK ] 0.57 sec. 2026-03-09 10:28:47 01009_insert_select_data_loss: [ OK ] 0.49 sec. 2026-03-09 10:28:47 00834_date_datetime_cmp: [ OK ] 0.47 sec. 2026-03-09 10:28:51 00981_topK_topKWeighted_long: [ OK ] 6.49 sec. 2026-03-09 10:28:52 01780_column_sparse_pk: [ OK ] 0.69 sec. 2026-03-09 10:28:53 02711_server_uuid_macro: [ OK ] 0.62 sec. 2026-03-09 10:28:54 02911_arrow_large_list: [ OK ] 0.92 sec. 2026-03-09 10:28:56 03036_dynamic_read_shared_subcolumns_compact_merge_tree: [ OK ] 54.97 sec. 2026-03-09 10:28:56 03033_final_undefined_last_mark: [ OK ] 0.22 sec. 2026-03-09 10:28:57 01802_rank_corr_mann_whitney_over_window: [ OK ] 0.60 sec. 2026-03-09 10:28:57 00292_parser_tuple_element: [ OK ] 0.52 sec. 2026-03-09 10:28:58 02703_max_local_read_bandwidth: [ OK ] 26.14 sec. 2026-03-09 10:28:58 01020_function_char: [ OK ] 0.52 sec. 2026-03-09 10:28:58 03208_array_of_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec. 2026-03-09 10:28:58 Reason: not running for current build 2026-03-09 10:28:58 02129_skip_quoted_fields: [ OK ] 13.58 sec. 2026-03-09 10:28:58 01017_tuplehamming_distance: [ OK ] 0.48 sec. 2026-03-09 10:28:59 01418_index_analysis_bug: [ OK ] 0.62 sec. 2026-03-09 10:28:59 01631_date_overflow_as_partition_key: [ OK ] 0.47 sec. 2026-03-09 10:28:59 00688_low_cardinality_in: [ OK ] 0.63 sec. 2026-03-09 10:28:59 01527_bad_aggregation_in_lambda: [ OK ] 0.43 sec. 2026-03-09 10:28:59 00384_column_aggregate_function_insert_from: [ OK ] 0.57 sec. 2026-03-09 10:29:00 01122_totals_rollup_having_block_header: [ OK ] 0.64 sec. 2026-03-09 10:29:01 02096_bad_options_in_client_and_local: [ OK ] 2.13 sec. 2026-03-09 10:29:01 03144_alter_column_and_read: [ OK ] 0.47 sec. 2026-03-09 10:29:02 02514_tsv_zero_started_number: [ OK ] 0.48 sec. 2026-03-09 10:29:02 02346_read_in_order_fixed_prefix: [ OK ] 14.69 sec. 2026-03-09 10:29:02 02907_clickhouse_dictionary_bug: [ OK ] 1.12 sec. 2026-03-09 10:29:02 02030_rocksdb_race_long: [ OK ] 21.67 sec. 2026-03-09 10:29:02 02026_arrayDifference_const: [ OK ] 0.42 sec. 2026-03-09 10:29:02 02122_parallel_formatting_CustomSeparated: [ OK ] 3.09 sec. 2026-03-09 10:29:02 01553_datetime64_comparison: [ OK ] 0.48 sec. 2026-03-09 10:29:02 00538_datediff_plural_units: [ OK ] 0.48 sec. 2026-03-09 10:29:03 02192_comment: [ OK ] 0.47 sec. 2026-03-09 10:29:03 03131_deprecated_functions: [ OK ] 0.57 sec. 2026-03-09 10:29:03 01106_const_fixed_string_like: [ OK ] 0.67 sec. 2026-03-09 10:29:04 00904_array_with_constant_2: [ OK ] 0.48 sec. 2026-03-09 10:29:04 02845_arrayShiftRotate: [ OK ] 0.93 sec. 2026-03-09 10:29:04 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec. 2026-03-09 10:29:04 Reason: not running for current build 2026-03-09 10:29:04 00714_alter_uuid: [ OK ] 0.67 sec. 2026-03-09 10:29:04 02695_logical_optimizer_alias_bug: [ OK ] 0.52 sec. 2026-03-09 10:29:04 02935_ipv6_bit_operations: [ OK ] 0.47 sec. 2026-03-09 10:29:05 01414_freeze_does_not_prevent_alters: [ OK ] 0.68 sec. 2026-03-09 10:29:05 01037_zookeeper_check_table_empty_pk: [ OK ] 0.57 sec. 2026-03-09 10:29:05 01666_gcd_ubsan: [ OK ] 0.72 sec. 2026-03-09 10:29:05 02735_system_zookeeper_connection: [ OK ] 0.53 sec. 2026-03-09 10:29:05 01069_insert_float_as_nullable_unit8: [ OK ] 0.52 sec. 2026-03-09 10:29:06 02353_partition_prune_nullable_key: [ OK ] 0.57 sec. 2026-03-09 10:29:06 01767_timezoneOf: [ OK ] 0.93 sec. 2026-03-09 10:29:06 01663_quantile_weighted_overflow: [ OK ] 0.47 sec. 2026-03-09 10:29:06 02540_date_column_consistent_insert_behaviour: [ OK ] 1.02 sec. 2026-03-09 10:29:07 02920_rename_column_of_skip_indices: [ OK ] 0.53 sec. 2026-03-09 10:29:07 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.43 sec. 2026-03-09 10:29:07 02369_analyzer_array_join_function: [ OK ] 0.68 sec. 2026-03-09 10:29:07 02903_bug_43644: [ OK ] 0.52 sec. 2026-03-09 10:29:07 01323_add_scalars_in_time: [ OK ] 0.63 sec. 2026-03-09 10:29:07 01019_alter_materialized_view_atomic: [ SKIPPED ] 0.00 sec. 2026-03-09 10:29:07 Reason: not running for current build 2026-03-09 10:29:08 01868_order_by_fill_with_datetime64: [ OK ] 0.47 sec. 2026-03-09 10:29:08 01583_parallel_parsing_exception_with_offset: [ OK ] 5.70 sec. 2026-03-09 10:29:08 01621_clickhouse_compressor: [ OK ] 0.96 sec. 2026-03-09 10:29:08 01035_prewhere_with_alias: [ OK ] 0.47 sec. 2026-03-09 10:29:09 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.48 sec. 2026-03-09 10:29:09 01352_generate_random_overflow: [ OK ] 0.47 sec. 2026-03-09 10:29:09 01892_setting_limit_offset_distributed: [ OK ] 0.52 sec. 2026-03-09 10:29:10 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 8.10 sec. 2026-03-09 10:29:11 00732_base64_functions: [ OK ] 0.73 sec. 2026-03-09 10:29:11 02941_variant_type_4: [ OK ] 23.63 sec. 2026-03-09 10:29:11 00908_long_http_insert: [ OK ] 1.59 sec. 2026-03-09 10:29:11 02973_parse_crlf_with_tsv_files: [ OK ] 2.28 sec. 2026-03-09 10:29:12 02766_bitshift_with_const_arguments: [ OK ] 0.57 sec. 2026-03-09 10:29:12 01851_hedged_connections_external_tables: [ OK ] 0.80 sec. 2026-03-09 10:29:12 03034_normalized_ast: [ OK ] 0.53 sec. 2026-03-09 10:29:12 02894_ast_depth_check: [ OK ] 1.64 sec. 2026-03-09 10:29:13 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 0.79 sec. 2026-03-09 10:29:14 00973_uniq_non_associativity: [ OK ] 1.69 sec. 2026-03-09 10:29:14 02136_scalar_progress: [ OK ] 1.04 sec. 2026-03-09 10:29:14 01558_ttest_scipy: [ OK ] 2.78 sec. 2026-03-09 10:29:15 01413_truncate_without_table_keyword: [ OK ] 0.47 sec. 2026-03-09 10:29:15 01720_union_distinct_with_limit: [ OK ] 0.69 sec. 2026-03-09 10:29:15 02052_last_granula_adjust_logical_error: [ OK ] 1.09 sec. 2026-03-09 10:29:16 03200_memory_engine_alter_dynamic: [ OK ] 0.79 sec. 2026-03-09 10:29:17 01932_global_in_function: [ OK ] 0.59 sec. 2026-03-09 10:29:18 02346_position_countsubstrings_zero_byte: [ OK ] 0.77 sec. 2026-03-09 10:29:19 02221_parallel_replicas_bug: [ OK ] 3.30 sec. 2026-03-09 10:29:19 01398_in_tuple_func: [ OK ] 0.58 sec. 2026-03-09 10:29:19 01632_tinylog_read_write: [ OK ] 11.16 sec. 2026-03-09 10:29:20 00437_nulls_first_last: [ OK ] 0.73 sec. 2026-03-09 10:29:21 01674_unicode_asan: [ OK ] 0.52 sec. 2026-03-09 10:29:21 01273_arrow_stream: [ OK ] 27.74 sec. 2026-03-09 10:29:22 02552_client_format_settings: [ OK ] 0.48 sec. 2026-03-09 10:29:22 00823_sequence_match_dfa: [ OK ] 1.42 sec. 2026-03-09 10:29:22 01423_if_nullable_cond: [ OK ] 0.42 sec. 2026-03-09 10:29:23 02716_int256_arrayfunc: [ OK ] 0.52 sec. 2026-03-09 10:29:23 02477_invalid_reads: [ OK ] 1.23 sec. 2026-03-09 10:29:23 00266_read_overflow_mode: [ OK ] 0.48 sec. 2026-03-09 10:29:24 03010_read_system_parts_table_test: [ OK ] 0.52 sec. 2026-03-09 10:29:24 01891_partition_hash_no_long_int: [ OK ] 0.57 sec. 2026-03-09 10:29:24 02293_h3_line: [ OK ] 0.68 sec. 2026-03-09 10:29:25 01034_with_fill_and_push_down_predicate: [ OK ] 0.42 sec. 2026-03-09 10:29:25 01040_distributed_background_insert_batch_inserts: [ OK ] 0.78 sec. 2026-03-09 10:29:25 02007_join_use_nulls: [ OK ] 0.52 sec. 2026-03-09 10:29:26 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 0.53 sec. 2026-03-09 10:29:26 02967_fuzz_bad_cast: [ OK ] 0.52 sec. 2026-03-09 10:29:27 02675_predicate_push_down_filled_join_fix: [ OK ] 0.52 sec. 2026-03-09 10:29:27 02306_window_move_row_number_fix: [ OK ] 0.42 sec. 2026-03-09 10:29:30 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.45 sec. 2026-03-09 10:29:31 01544_errorCodeToName: [ OK ] 0.48 sec. 2026-03-09 10:29:31 00386_long_in_pk: [ OK ] 16.00 sec. 2026-03-09 10:29:31 01213_alter_table_rename_nested: [ OK ] 0.52 sec. 2026-03-09 10:29:32 00183_skip_unavailable_shards: [ OK ] 24.49 sec. 2026-03-09 10:29:32 01155_old_mutation_parts_to_do: [ OK ] 12.89 sec. 2026-03-09 10:29:32 02456_aggregate_state_conversion: [ OK ] 0.48 sec. 2026-03-09 10:29:32 00554_nested_and_table_engines: [ OK ] 0.82 sec. 2026-03-09 10:29:33 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 0.47 sec. 2026-03-09 10:29:33 02381_compress_marks_and_primary_key: [ OK ] 1.94 sec. 2026-03-09 10:29:33 00723_remerge_sort: [ OK ] 0.63 sec. 2026-03-09 10:29:33 00996_limit_with_ties: [ OK ] 0.67 sec. 2026-03-09 10:29:33 01269_create_with_null: [ OK ] 0.47 sec. 2026-03-09 10:29:33 01774_case_sensitive_connection_id: [ OK ] 0.48 sec. 2026-03-09 10:29:33 02861_interpolate_alias_precedence: [ OK ] 0.47 sec. 2026-03-09 10:29:34 03215_view_with_recursive: [ OK ] 0.67 sec. 2026-03-09 10:29:34 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.53 sec. 2026-03-09 10:29:34 01766_todatetime64_no_timezone_arg: [ OK ] 0.47 sec. 2026-03-09 10:29:34 01825_new_type_json_bools: [ OK ] 0.53 sec. 2026-03-09 10:29:35 01448_json_compact_strings_each_row: [ OK ] 0.98 sec. 2026-03-09 10:29:35 00808_not_optimize_predicate: [ OK ] 0.72 sec. 2026-03-09 10:29:35 02893_bad_sample_view: [ OK ] 0.48 sec. 2026-03-09 10:29:35 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.47 sec. 2026-03-09 10:29:36 01358_lc_parquet: [ OK ] 8.21 sec. 2026-03-09 10:29:36 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.53 sec. 2026-03-09 10:29:36 02011_tuple_vector_functions: [ OK ] 1.33 sec. 2026-03-09 10:29:36 02020_exponential_smoothing: [ OK ] 1.44 sec. 2026-03-09 10:29:36 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 2.68 sec. 2026-03-09 10:29:36 02578_ipv4_codec_t64: [ OK ] 0.42 sec. 2026-03-09 10:29:36 02497_if_transform_strings_to_enum: [ OK ] 0.77 sec. 2026-03-09 10:29:36 01736_null_as_default: [ OK ] 0.44 sec. 2026-03-09 10:29:36 00527_totals_having_nullable: [ OK ] 0.48 sec. 2026-03-09 10:29:37 01585_use_index_for_global_in: [ OK ] 0.52 sec. 2026-03-09 10:29:37 02354_numeric_literals_with_underscores: [ OK ] 0.42 sec. 2026-03-09 10:29:37 02503_join_switch_alias_fuzz: [ OK ] 0.42 sec. 2026-03-09 10:29:37 02811_primary_key_in_columns: [ OK ] 0.68 sec. 2026-03-09 10:29:37 01780_range_msan: [ OK ] 0.47 sec. 2026-03-09 10:29:37 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.52 sec. 2026-03-09 10:29:38 00459_group_array_insert_at: [ OK ] 0.53 sec. 2026-03-09 10:29:38 00753_alter_destination_for_storage_buffer: [ OK ] 0.67 sec. 2026-03-09 10:29:38 00358_from_string_complex_types: [ OK ] 0.47 sec. 2026-03-09 10:29:38 02150_replace_regexp_all_empty_match: [ OK ] 0.42 sec. 2026-03-09 10:29:38 03222_json_squashing: [ OK ] 1.38 sec. 2026-03-09 10:29:39 02900_matview_create_to_errors: [ OK ] 0.98 sec. 2026-03-09 10:29:41 00328_long_case_construction: [ OK ] 23.13 sec. 2026-03-09 10:29:41 00125_array_element_of_array_of_tuple: [ OK ] 0.43 sec. 2026-03-09 10:29:42 01961_roaring_memory_tracking: [ OK ] 5.65 sec. 2026-03-09 10:29:42 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 3.73 sec. 2026-03-09 10:29:42 02476_analyzer_join_with_unused_columns: [ OK ] 0.49 sec. 2026-03-09 10:29:42 01623_byte_size_const: [ OK ] 0.47 sec. 2026-03-09 10:29:43 00947_ml_test: [ OK ] 0.63 sec. 2026-03-09 10:29:43 00974_full_outer_join: [ OK ] 0.43 sec. 2026-03-09 10:29:43 02813_series_period_detect: [ OK ] 0.63 sec. 2026-03-09 10:29:43 01947_mv_subquery: [ OK ] 1.48 sec. 2026-03-09 10:29:43 03002_int_div_decimal_with_date_bug: [ OK ] 0.48 sec. 2026-03-09 10:29:44 01548_uncomparable_columns_in_keys: [ OK ] 0.47 sec. 2026-03-09 10:29:44 01377_supertype_low_cardinality: [ OK ] 0.69 sec. 2026-03-09 10:29:44 02840_grace_hash_join_structure_mismatch: [ OK ] 0.52 sec. 2026-03-09 10:29:45 00205_scalar_subqueries: [ OK ] 0.69 sec. 2026-03-09 10:29:45 03009_format_show_database: [ OK ] 1.35 sec. 2026-03-09 10:29:45 02476_query_parameters_without_serialisation: [ OK ] 0.54 sec. 2026-03-09 10:29:46 03035_dynamic_sorting: [ OK ] 0.62 sec. 2026-03-09 10:29:46 00098_7_union_all: [ OK ] 0.47 sec. 2026-03-09 10:29:46 01406_carriage_return_in_tsv_csv: [ OK ] 2.09 sec. 2026-03-09 10:29:46 02428_combinators_with_over_statement: [ OK ] 0.52 sec. 2026-03-09 10:29:47 00897_flatten: [ OK ] 0.48 sec. 2026-03-09 10:29:47 00059_shard_global_in: [ OK ] 0.52 sec. 2026-03-09 10:29:47 02687_native_fuzz: [ OK ] 0.48 sec. 2026-03-09 10:29:47 02122_join_group_by_timeout: [ OK ] 7.87 sec. 2026-03-09 10:29:48 02699_polygons_sym_difference_rollup: [ OK ] 0.54 sec. 2026-03-09 10:29:48 02160_client_autocomplete_parse_query: [ OK ] 2.13 sec. 2026-03-09 10:29:48 00506_shard_global_in_union: [ OK ] 0.77 sec. 2026-03-09 10:29:48 01663_test_toDate_mysql_compatibility: [ OK ] 0.42 sec. 2026-03-09 10:29:49 02344_analyzer_multiple_aliases_for_expression: [ OK ] 0.57 sec. 2026-03-09 10:29:49 02315_readonly_create_function: [ OK ] 1.12 sec. 2026-03-09 10:29:49 02472_segfault_expression_parser: [ OK ] 0.42 sec. 2026-03-09 10:29:50 00825_protobuf_format_splitted_nested: [ OK ] 2.78 sec. 2026-03-09 10:29:50 02882_primary_key_index_in_function_different_types: [ OK ] 0.58 sec. 2026-03-09 10:29:50 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 0.53 sec. 2026-03-09 10:29:50 02912_group_array_sample: [ OK ] 0.48 sec. 2026-03-09 10:29:50 02477_age_datetime64: [ OK ] 0.88 sec. 2026-03-09 10:29:51 00098_k_union_all: [ OK ] 0.52 sec. 2026-03-09 10:29:51 00102_insert_into_temporary_table: [ OK ] 0.42 sec. 2026-03-09 10:29:51 02864_restore_table_with_broken_part: [ OK ] 3.19 sec. 2026-03-09 10:29:51 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 13.12 sec. 2026-03-09 10:29:51 03126_column_not_under_group_by: [ OK ] 0.43 sec. 2026-03-09 10:29:51 00916_join_using_duplicate_columns: [ OK ] 0.63 sec. 2026-03-09 10:29:51 01383_log_broken_table: [ OK ] 40.09 sec. 2026-03-09 10:29:51 02918_join_pm_lc_crash: [ OK ] 0.48 sec. 2026-03-09 10:29:52 02889_print_pretty_type_names: [ OK ] 0.47 sec. 2026-03-09 10:29:52 02962_indexHint_rpn_construction: [ OK ] 0.52 sec. 2026-03-09 10:29:52 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 0.58 sec. 2026-03-09 10:29:52 02770_jit_aggregation_nullable_key_fix: [ OK ] 0.98 sec. 2026-03-09 10:29:52 02581_width_bucket: [ OK ] 1.03 sec. 2026-03-09 10:29:52 02764_index_analysis_fix: [ OK ] 0.48 sec. 2026-03-09 10:29:52 01925_map_populate_series_on_map: [ OK ] 0.87 sec. 2026-03-09 10:29:53 02325_dates_schema_inference: [ OK ] 0.83 sec. 2026-03-09 10:29:53 02720_row_policy_column_with_dots: [ OK ] 0.52 sec. 2026-03-09 10:29:53 01009_global_array_join_names: [ OK ] 0.57 sec. 2026-03-09 10:29:53 00829_bitmap64_function: [ OK ] 0.62 sec. 2026-03-09 10:29:53 01676_range_hashed_dictionary: [ OK ] 0.98 sec. 2026-03-09 10:29:54 03033_set_index_in: [ OK ] 0.83 sec. 2026-03-09 10:29:54 01593_insert_settings: [ OK ] 0.58 sec. 2026-03-09 10:29:54 03047_analyzer_alias_join: [ OK ] 0.47 sec. 2026-03-09 10:29:54 02875_json_array_as_string: [ OK ] 0.42 sec. 2026-03-09 10:29:54 01825_new_type_json_nbagames: [ OK ] 16.21 sec. 2026-03-09 10:29:54 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 1.73 sec. 2026-03-09 10:29:54 02541_empty_function_support_ip: [ OK ] 0.52 sec. 2026-03-09 10:29:55 02725_object_column_alter: [ OK ] 0.47 sec. 2026-03-09 10:29:55 01475_read_subcolumns_2: [ OK ] 0.78 sec. 2026-03-09 10:29:55 00164_not_chain: [ OK ] 0.47 sec. 2026-03-09 10:29:55 02722_matcher_join_use_nulls: [ OK ] 1.12 sec. 2026-03-09 10:29:55 03224_json_merges_new_type_in_shared_data: [ OK ] 0.63 sec. 2026-03-09 10:29:55 01010_pm_join_all_join_bug: [ OK ] 0.57 sec. 2026-03-09 10:29:55 02874_toDaysSinceYearZero: [ OK ] 0.67 sec. 2026-03-09 10:29:55 03203_fill_missed_subcolumns: [ OK ] 0.68 sec. 2026-03-09 10:29:56 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 0.47 sec. 2026-03-09 10:29:56 02352_interactive_queries_from_file: [ OK ] 1.32 sec. 2026-03-09 10:29:56 01801_s3_cluster_count: [ OK ] 0.57 sec. 2026-03-09 10:29:56 00686_client_exit_code: [ OK ] 1.07 sec. 2026-03-09 10:29:57 01622_defaults_for_url_engine: [ OK ] 1.18 sec. 2026-03-09 10:29:57 01050_group_array_sample: [ OK ] 0.47 sec. 2026-03-09 10:29:57 00263_merge_aggregates_and_overflow: [ OK ] 0.58 sec. 2026-03-09 10:29:57 00826_cross_to_inner_join: [ OK ] 0.88 sec. 2026-03-09 10:29:57 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 3.35 sec. 2026-03-09 10:29:57 01457_order_by_nulls_first: [ OK ] 0.67 sec. 2026-03-09 10:29:57 03167_empty_tuple_concat: [ OK ] 0.42 sec. 2026-03-09 10:29:57 01832_memory_write_suffix: [ OK ] 0.48 sec. 2026-03-09 10:29:57 02841_join_filter_set_sparse: [ OK ] 0.58 sec. 2026-03-09 10:29:57 01710_projection_row_policy: [ OK ] 0.57 sec. 2026-03-09 10:29:58 00515_shard_desc_table_functions_and_subqueries: [ OK ] 0.57 sec. 2026-03-09 10:29:58 02995_preliminary_filters_duplicated_columns: [ OK ] 0.47 sec. 2026-03-09 10:29:58 00275_shard_quantiles_weighted: [ OK ] 0.82 sec. 2026-03-09 10:29:58 02125_lz4_compression_bug_TSKV: [ OK ] 7.50 sec. 2026-03-09 10:29:58 02426_pod_array_overflow_3: [ OK ] 0.43 sec. 2026-03-09 10:29:58 03116_analyzer_explicit_alias_as_column_name: [ OK ] 0.48 sec. 2026-03-09 10:29:58 01890_jit_aggregation_function_sum_long: [ OK ] 1.38 sec. 2026-03-09 10:29:58 00933_alter_ttl: [ OK ] 0.63 sec. 2026-03-09 10:29:58 02021_map_bloom_filter_index: [ OK ] 1.08 sec. 2026-03-09 10:29:58 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.42 sec. 2026-03-09 10:29:59 01901_in_literal_shard_prune: [ OK ] 0.52 sec. 2026-03-09 10:29:59 03213_rand_dos: [ OK ] 0.53 sec. 2026-03-09 10:29:59 00063_check_query: [ OK ] 0.57 sec. 2026-03-09 10:29:59 01818_case_float_value_fangyc: [ OK ] 0.47 sec. 2026-03-09 10:29:59 01753_mutate_table_predicated_with_table: [ OK ] 0.53 sec. 2026-03-09 10:29:59 01505_log_distributed_deadlock: [ OK ] 0.48 sec. 2026-03-09 10:29:59 00566_enum_min_max: [ OK ] 0.52 sec. 2026-03-09 10:29:59 02782_avro_decimals: [ OK ] 1.07 sec. 2026-03-09 10:29:59 02004_max_hyperscan_regex_length: [ SKIPPED ] 0.00 sec. 2026-03-09 10:29:59 Reason: not running for current build 2026-03-09 10:29:59 01324_settings_documentation: [ OK ] 0.48 sec. 2026-03-09 10:30:00 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 0.48 sec. 2026-03-09 10:30:00 02029_quantile_sanitizer: [ OK ] 0.44 sec. 2026-03-09 10:30:00 03204_format_join_on: [ OK ] 0.82 sec. 2026-03-09 10:30:00 02267_jsonlines_ndjson_format: [ OK ] 0.47 sec. 2026-03-09 10:30:00 00814_parsing_ub: [ OK ] 0.48 sec. 2026-03-09 10:30:01 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 1.63 sec. 2026-03-09 10:30:01 02787_transform_null: [ OK ] 0.62 sec. 2026-03-09 10:30:01 01650_expressions_merge_bug: [ OK ] 0.42 sec. 2026-03-09 10:30:01 01442_date_time_with_params: [ OK ] 1.40 sec. 2026-03-09 10:30:01 01634_summap_nullable: [ OK ] 0.47 sec. 2026-03-09 10:30:02 01355_CSV_input_format_allow_errors: [ OK ] 2.48 sec. 2026-03-09 10:30:02 00976_max_execution_speed: [ OK ] 3.48 sec. 2026-03-09 10:30:02 02553_new_type_json_attach_partition: [ OK ] 0.62 sec. 2026-03-09 10:30:02 03153_format_regexp_usability: [ OK ] 1.43 sec. 2026-03-09 10:30:02 00149_function_url_hash: [ OK ] 0.53 sec. 2026-03-09 10:30:02 02122_parallel_formatting_JSONCompactStrings: [ OK ] 3.85 sec. 2026-03-09 10:30:03 01410_nullable_key_and_index: [ OK ] 1.08 sec. 2026-03-09 10:30:03 01100_split_by_string: [ OK ] 0.47 sec. 2026-03-09 10:30:03 01554_row_number_after_cannot_read_all_data: [ OK ] 1.29 sec. 2026-03-09 10:30:03 00300_csv: [ OK ] 0.42 sec. 2026-03-09 10:30:03 02012_compress_lz4: [ OK ] 1.63 sec. 2026-03-09 10:30:04 01359_codeql: [ OK ] 0.47 sec. 2026-03-09 10:30:04 03456_match_index_prefix_extraction: [ OK ] 1.12 sec. 2026-03-09 10:30:04 02458_datediff_date32: [ OK ] 0.82 sec. 2026-03-09 10:30:04 00944_ml_test: [ OK ] 0.57 sec. 2026-03-09 10:30:04 02880_indexHint__partition_id: [ OK ] 0.52 sec. 2026-03-09 10:30:05 00147_alter_nested_default: [ OK ] 0.62 sec. 2026-03-09 10:30:05 00666_uniq_complex_types: [ OK ] 0.83 sec. 2026-03-09 10:30:05 00800_low_cardinality_empty_array: [ OK ] 0.48 sec. 2026-03-09 10:30:05 01940_totimezone_operator_monotonicity: [ OK ] 0.53 sec. 2026-03-09 10:30:06 00988_parallel_parts_removal: [ OK ] 3.84 sec. 2026-03-09 10:30:06 02426_orc_bug: [ OK ] 1.13 sec. 2026-03-09 10:30:06 00596_limit_on_expanded_ast: [ OK ] 1.32 sec. 2026-03-09 10:30:06 00649_quantile_tdigest_negative: [ OK ] 0.52 sec. 2026-03-09 10:30:06 01811_storage_buffer_flush_parameters: [ OK ] 3.94 sec. 2026-03-09 10:30:06 01120_join_constants: [ OK ] 0.47 sec. 2026-03-09 10:30:07 02538_analyzer_create_table_as_select: [ OK ] 0.53 sec. 2026-03-09 10:30:07 02251_last_day_of_month: [ OK ] 0.52 sec. 2026-03-09 10:30:07 00903_array_with_constant_function: [ OK ] 0.42 sec. 2026-03-09 10:30:07 01762_deltasumtimestamp: [ OK ] 0.62 sec. 2026-03-09 10:30:07 00829_bitmap_function: [ OK ] 1.98 sec. 2026-03-09 10:30:07 03023_remove_unused_column_distinct: [ OK ] 0.48 sec. 2026-03-09 10:30:07 02680_datetime64_monotonic_check: [ OK ] 0.52 sec. 2026-03-09 10:30:07 01797_StripeLog_rwlock_ub: [ OK ] 0.52 sec. 2026-03-09 10:30:08 01634_sum_map_nulls: [ OK ] 0.48 sec. 2026-03-09 10:30:08 01535_decimal_round_scale_overflow_check: [ OK ] 0.47 sec. 2026-03-09 10:30:08 01402_cast_nullable_string_to_enum: [ OK ] 0.62 sec. 2026-03-09 10:30:08 02024_create_dictionary_with_comment: [ OK ] 0.37 sec. 2026-03-09 10:30:08 02963_single_value_destructor: [ OK ] 0.67 sec. 2026-03-09 10:30:09 01032_cityHash64_for_decimal: [ OK ] 0.52 sec. 2026-03-09 10:30:09 01293_client_interactive_vertical_singleline: [ OK ] 1.14 sec. 2026-03-09 10:30:10 03015_peder1001: [ OK ] 0.47 sec. 2026-03-09 10:30:10 00940_order_by_read_in_order_query_plan: [ OK ] 1.68 sec. 2026-03-09 10:30:11 01139_asof_join_types: [ OK ] 0.58 sec. 2026-03-09 10:30:11 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.52 sec. 2026-03-09 10:30:11 02574_suspicious_low_cardinality_msan: [ OK ] 0.62 sec. 2026-03-09 10:30:12 03167_parametrized_view_with_cte: [ OK ] 0.62 sec. 2026-03-09 10:30:13 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 1.08 sec. 2026-03-09 10:30:13 03156_analyzer_array_join_distributed: [ OK ] 0.62 sec. 2026-03-09 10:30:15 00954_client_prepared_statements: [ OK ] 7.25 sec. 2026-03-09 10:30:15 00431_if_nulls: [ OK ] 1.59 sec. 2026-03-09 10:30:15 02521_tsv_csv_custom_header_detection: [ OK ] 11.58 sec. 2026-03-09 10:30:15 00875_join_right_nulls_ors: [ OK ] 0.67 sec. 2026-03-09 10:30:16 02377_analyzer_in_function_set: [ OK ] 0.53 sec. 2026-03-09 10:30:16 02989_variant_comparison: [ OK ] 0.78 sec. 2026-03-09 10:30:16 01016_macros: [ OK ] 0.53 sec. 2026-03-09 10:30:17 01135_default_and_alter_zookeeper: [ OK ] 0.52 sec. 2026-03-09 10:30:17 02995_bad_formatting_union_intersect: [ OK ] 0.42 sec. 2026-03-09 10:30:18 02676_trailing_commas: [ OK ] 0.58 sec. 2026-03-09 10:30:19 02932_punycode: [ OK ] 1.13 sec. 2026-03-09 10:30:19 02984_form_format: [ OK ] 2.78 sec. 2026-03-09 10:30:19 03274_dynamic_column_data_race_with_concurrent_hj: [ OK ] 0.47 sec. 2026-03-09 10:30:20 01262_low_cardinality_remove: [ OK ] 0.63 sec. 2026-03-09 10:30:20 02354_parse_timedelta: [ OK ] 0.93 sec. 2026-03-09 10:30:20 03006_join_on_inequal_expression_3: [ OK ] 0.87 sec. 2026-03-09 10:30:21 00482_subqueries_and_aliases: [ OK ] 0.47 sec. 2026-03-09 10:30:22 02421_new_type_json_async_insert: [ OK ] 13.99 sec. 2026-03-09 10:30:22 02785_global_join_too_many_columns: [ OK ] 0.52 sec. 2026-03-09 10:30:23 02661_read_from_archive_tzst: [ OK ] 15.35 sec. 2026-03-09 10:30:23 00197_if_fixed_string: [ OK ] 0.52 sec. 2026-03-09 10:30:23 02366_kql_tabular: [ OK ] 0.72 sec. 2026-03-09 10:30:24 01825_type_json_7: [ OK ] 3.13 sec. 2026-03-09 10:30:24 02997_projections_formatting: [ OK ] 0.37 sec. 2026-03-09 10:30:24 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 0.52 sec. 2026-03-09 10:30:24 01903_http_fields: [ OK ] 1.73 sec. 2026-03-09 10:30:25 02782_values_null_to_lc_nullable: [ OK ] 0.47 sec. 2026-03-09 10:30:25 02998_to_milliseconds: [ OK ] 0.57 sec. 2026-03-09 10:30:25 02461_welch_t_test_fuzz: [ OK ] 0.47 sec. 2026-03-09 10:30:25 01098_msgpack_format: [ OK ] 24.52 sec. 2026-03-09 10:30:26 02591_bson_long_tuple: [ OK ] 0.42 sec. 2026-03-09 10:30:26 03040_array_sum_and_join: [ OK ] 0.52 sec. 2026-03-09 10:30:26 02017_columns_with_dot: [ OK ] 0.57 sec. 2026-03-09 10:30:26 00974_fix_join_on: [ OK ] 0.77 sec. 2026-03-09 10:30:27 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ OK ] 6.09 sec. 2026-03-09 10:30:27 03093_filter_push_down_crash: [ OK ] 0.52 sec. 2026-03-09 10:30:27 00523_aggregate_functions_in_group_array: [ OK ] 0.47 sec. 2026-03-09 10:30:27 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 0.57 sec. 2026-03-09 10:30:27 02567_native_type_conversions: [ OK ] 1.93 sec. 2026-03-09 10:30:28 00616_final_single_part: [ OK ] 0.57 sec. 2026-03-09 10:30:28 02240_asof_join_biginteger: [ OK ] 0.57 sec. 2026-03-09 10:30:29 01960_lambda_precedence: [ OK ] 0.48 sec. 2026-03-09 10:30:29 03031_filter_float64_logical_error: [ OK ] 0.47 sec. 2026-03-09 10:30:29 00351_select_distinct_arrays_tuples: [ OK ] 0.42 sec. 2026-03-09 10:30:29 02806_cte_block_cannot_be_empty: [ OK ] 0.47 sec. 2026-03-09 10:30:30 01774_bar_with_illegal_value: [ OK ] 0.47 sec. 2026-03-09 10:30:30 02226_low_cardinality_text_bloom_filter_index: [ OK ] 0.87 sec. 2026-03-09 10:30:31 01556_explain_select_with_union_query: [ OK ] 0.57 sec. 2026-03-09 10:30:31 01927_query_views_log_current_database: [ OK ] 1.23 sec. 2026-03-09 10:30:31 02572_max_intersections: [ OK ] 0.42 sec. 2026-03-09 10:30:32 02915_analyzer_fuzz_6: [ OK ] 0.62 sec. 2026-03-09 10:30:32 01599_multiline_input_and_singleline_comments: [ OK ] 1.18 sec. 2026-03-09 10:30:33 02313_test_fpc_codec: [ OK ] 0.82 sec. 2026-03-09 10:30:33 00804_rollup_with_having: [ OK ] 0.53 sec. 2026-03-09 10:30:33 03036_schema_inference_cache_s3_archives: [ OK ] 5.34 sec. 2026-03-09 10:30:33 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 9.05 sec. 2026-03-09 10:30:33 02294_system_certificates: [ OK ] 0.43 sec. 2026-03-09 10:30:33 01010_pmj_on_disk: [ OK ] 0.62 sec. 2026-03-09 10:30:33 02915_analyzer_fuzz_1: [ OK ] 0.47 sec. 2026-03-09 10:30:33 00843_optimize_predicate_and_rename_table: [ OK ] 0.52 sec. 2026-03-09 10:30:33 02982_create_mv_inner_extra: [ OK ] 0.43 sec. 2026-03-09 10:30:34 02815_alias_to_length: [ OK ] 0.48 sec. 2026-03-09 10:30:34 03010_sum_to_to_count_if_nullable: [ OK ] 0.57 sec. 2026-03-09 10:30:34 00725_join_on_bug_1: [ OK ] 0.47 sec. 2026-03-09 10:30:34 01084_regexp_empty: [ OK ] 0.47 sec. 2026-03-09 10:30:34 01926_bin_unbin: [ OK ] 0.67 sec. 2026-03-09 10:30:34 03143_group_by_constant_secondary: [ OK ] 0.42 sec. 2026-03-09 10:30:34 00048_a_stored_aggregates_merge: [ OK ] 0.53 sec. 2026-03-09 10:30:35 03164_analyzer_validate_tree_size: [ OK ] 0.77 sec. 2026-03-09 10:30:35 00098_1_union_all: [ OK ] 0.57 sec. 2026-03-09 10:30:35 02415_all_new_functions_must_be_documented: [ OK ] 0.48 sec. 2026-03-09 10:30:35 03023_zeros_generate_random_with_limit_progress_bar: [ OK ] 0.82 sec. 2026-03-09 10:30:36 02918_template_format_deadlock: [ OK ] 0.97 sec. 2026-03-09 10:30:36 02833_local_with_dialect: [ OK ] 1.12 sec. 2026-03-09 10:30:37 00846_join_using_tuple_crash: [ OK ] 0.47 sec. 2026-03-09 10:30:37 00368_format_option_collision: [ OK ] 1.23 sec. 2026-03-09 10:30:37 01069_materialized_view_alter_target_table: [ OK ] 0.58 sec. 2026-03-09 10:30:38 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 0.48 sec. 2026-03-09 10:30:38 02474_timeDiff_UTCTimestamp: [ OK ] 0.53 sec. 2026-03-09 10:30:38 01035_avg: [ OK ] 2.68 sec. 2026-03-09 10:30:38 00570_empty_array_is_const: [ OK ] 0.47 sec. 2026-03-09 10:30:38 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.42 sec. 2026-03-09 10:30:39 01812_has_generic: [ OK ] 0.42 sec. 2026-03-09 10:30:39 00453_cast_enum: [ OK ] 0.53 sec. 2026-03-09 10:30:40 02844_max_backup_bandwidth_s3: [ OK ] 28.59 sec. 2026-03-09 10:30:40 01825_type_json_2: [ OK ] 0.77 sec. 2026-03-09 10:30:40 01550_type_map_formats_input: [ OK ] 5.79 sec. 2026-03-09 10:30:40 01333_select_abc_asterisk: [ OK ] 0.48 sec. 2026-03-09 10:30:41 00148_summing_merge_tree_aggregate_function: [ OK ] 2.63 sec. 2026-03-09 10:30:41 01278_variance_nonnegative: [ OK ] 0.58 sec. 2026-03-09 10:30:41 03210_dynamic_squashing: [ OK ] 0.99 sec. 2026-03-09 10:30:41 00161_rounding_functions: [ OK ] 0.97 sec. 2026-03-09 10:30:41 03063_analyzer_multi_join_wrong_table_specifier: [ OK ] 0.52 sec. 2026-03-09 10:30:42 03003_prql_panic: [ OK ] 1.17 sec. 2026-03-09 10:30:42 01273_arrow_nullable_arrays_load: [ OK ] 3.48 sec. 2026-03-09 10:30:42 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.47 sec. 2026-03-09 10:30:42 02354_vector_search_legacy_index_compatibility: [ OK ] 0.67 sec. 2026-03-09 10:30:42 02551_ipv4_implicit_uint64: [ OK ] 0.48 sec. 2026-03-09 10:30:42 03165_string_functions_with_token_text_indexes: [ OK ] 1.18 sec. 2026-03-09 10:30:42 00141_parse_timestamp_as_datetime: [ OK ] 0.52 sec. 2026-03-09 10:30:42 01436_storage_merge_with_join_push_down: [ OK ] 0.57 sec. 2026-03-09 10:30:43 02496_remove_redundant_sorting_analyzer: [ OK ] 16.58 sec. 2026-03-09 10:30:43 00975_sample_prewhere_distributed: [ OK ] 0.52 sec. 2026-03-09 10:30:43 02146_mv_non_phys: [ OK ] 0.47 sec. 2026-03-09 10:30:43 02374_analyzer_array_join: [ OK ] 0.87 sec. 2026-03-09 10:30:43 01073_show_tables_not_like: [ OK ] 0.73 sec. 2026-03-09 10:30:43 02910_nullable_enum_cast: [ OK ] 0.47 sec. 2026-03-09 10:30:43 00833_sleep_overflow: [ OK ] 0.48 sec. 2026-03-09 10:30:43 00098_l_union_all: [ OK ] 0.47 sec. 2026-03-09 10:30:43 02949_parallel_replicas_in_subquery: [ OK ] 0.82 sec. 2026-03-09 10:30:44 00647_select_numbers_with_offset: [ OK ] 0.42 sec. 2026-03-09 10:30:44 00606_quantiles_and_nans: [ OK ] 0.42 sec. 2026-03-09 10:30:44 02184_range_hashed_dictionary_outside_range_values: [ OK ] 0.52 sec. 2026-03-09 10:30:44 01271_show_privileges: [ OK ] 0.43 sec. 2026-03-09 10:30:44 03164_parallel_replicas_range_filter_min_max: [ OK ] 0.82 sec. 2026-03-09 10:30:44 02911_system_symbols: [ OK ] 0.97 sec. 2026-03-09 10:30:45 03129_cte_with_final: [ OK ] 0.52 sec. 2026-03-09 10:30:45 00662_has_nullable: [ OK ] 0.57 sec. 2026-03-09 10:30:45 01657_test_toHour_mysql_compatibility: [ OK ] 0.42 sec. 2026-03-09 10:30:45 02250_ON_CLUSTER_grant: [ OK ] 2.93 sec. 2026-03-09 10:30:46 03031_clickhouse_local_input: [ OK ] 1.59 sec. 2026-03-09 10:30:46 02932_idna: [ OK ] 1.53 sec. 2026-03-09 10:30:46 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.47 sec. 2026-03-09 10:30:46 00315_quantile_off_by_one: [ OK ] 0.52 sec. 2026-03-09 10:30:46 00165_transform_non_const_default: [ OK ] 0.62 sec. 2026-03-09 10:30:46 02422_insert_different_granularity: [ OK ] 0.92 sec. 2026-03-09 10:30:47 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 0.97 sec. 2026-03-09 10:30:48 00700_decimal_math: [ OK ] 0.62 sec. 2026-03-09 10:30:48 01081_window_view_target_table_engine: [ OK ] 2.93 sec. 2026-03-09 10:30:49 01134_max_rows_to_group_by: [ OK ] 0.57 sec. 2026-03-09 10:30:49 02513_prewhere_combine_step_filters: [ OK ] 0.67 sec. 2026-03-09 10:30:49 00679_replace_asterisk: [ OK ] 0.47 sec. 2026-03-09 10:30:50 03641_analyzer_issue_85834: [ OK ] 0.47 sec. 2026-03-09 10:30:50 02266_protobuf_format_google_wrappers: [ OK ] 6.64 sec. 2026-03-09 10:30:51 00593_union_all_assert_columns_removed: [ OK ] 0.47 sec. 2026-03-09 10:30:51 02884_string_distance_function: [ OK ] 0.97 sec. 2026-03-09 10:30:52 01825_new_type_json_7: [ OK ] 3.29 sec. 2026-03-09 10:30:53 01660_join_or_inner: [ OK ] 0.62 sec. 2026-03-09 10:30:53 03006_join_on_inequal_expression_2: [ OK ] 1.83 sec. 2026-03-09 10:30:53 00612_union_query_with_subquery: [ OK ] 0.42 sec. 2026-03-09 10:30:54 02454_set_parameters_formatting: [ OK ] 0.83 sec. 2026-03-09 10:30:54 02900_window_function_with_sparse_column: [ OK ] 0.52 sec. 2026-03-09 10:30:55 02844_table_function_url_filter_by_virtual_columns: [ OK ] 1.07 sec. 2026-03-09 10:30:55 02428_parameterized_view: [ OK ] 39.62 sec. 2026-03-09 10:30:56 00700_decimal_formats: [ OK ] 0.52 sec. 2026-03-09 10:30:56 02498_random_string_in_json_schema_inference: [ OK ] 0.98 sec. 2026-03-09 10:30:56 03049_unknown_identifier_materialized_column: [ OK ] 0.47 sec. 2026-03-09 10:30:56 02207_ttl_move_if_exists: [ OK ] 0.32 sec. 2026-03-09 10:30:57 02267_join_dup_columns_issue36199: [ OK ] 0.72 sec. 2026-03-09 10:30:57 03094_one_thousand_joins: [ OK ] 12.37 sec. 2026-03-09 10:30:58 01700_point_in_polygon_ubsan: [ OK ] 0.47 sec. 2026-03-09 10:30:58 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.53 sec. 2026-03-09 10:30:59 00618_nullable_in: [ OK ] 0.47 sec. 2026-03-09 10:30:59 03096_largest_triangle_3b_crash: [ OK ] 0.42 sec. 2026-03-09 10:31:00 02561_sorting_constants_and_distinct_crash: [ OK ] 2.88 sec. 2026-03-09 10:31:00 02995_index_3: [ SKIPPED ] 0.00 sec. 2026-03-09 10:31:00 Reason: not running for current build 2026-03-09 10:31:00 00964_bloom_index_string_functions: [ OK ] 13.87 sec. 2026-03-09 10:31:02 02480_tets_show_full: [ OK ] 1.63 sec. 2026-03-09 10:31:02 02160_h3_cell_area_m2: [ OK ] 0.52 sec. 2026-03-09 10:31:03 01651_group_uniq_array_enum: [ OK ] 0.48 sec. 2026-03-09 10:31:04 00653_verification_monotonic_data_load: [ OK ] 17.15 sec. 2026-03-09 10:31:04 01060_window_view_event_tumble_to_asc: [ OK ] 3.43 sec. 2026-03-09 10:31:04 01621_summap_check_types: [ OK ] 0.52 sec. 2026-03-09 10:31:04 00700_decimal_casts: [ OK ] 1.64 sec. 2026-03-09 10:31:05 00809_add_days_segfault: [ OK ] 0.58 sec. 2026-03-09 10:31:05 00048_b_stored_aggregates_merge: [ OK ] 0.52 sec. 2026-03-09 10:31:06 01825_type_json_partitions: [ OK ] 0.47 sec. 2026-03-09 10:31:06 00825_http_header_query_id: [ OK ] 0.72 sec. 2026-03-09 10:31:06 03212_thousand_exceptions: [ OK ] 15.68 sec. 2026-03-09 10:31:06 03221_mutate_profile_events: [ OK ] 0.77 sec. 2026-03-09 10:31:07 03246_skipping_index_70108: [ OK ] 1.17 sec. 2026-03-09 10:31:07 01603_remove_column_ttl: [ OK ] 0.53 sec. 2026-03-09 10:31:07 01291_distributed_low_cardinality_memory_efficient: [ OK ] 0.52 sec. 2026-03-09 10:31:07 01710_projection_with_mixed_pipeline: [ OK ] 0.63 sec. 2026-03-09 10:31:07 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 0.47 sec. 2026-03-09 10:31:08 02237_lzma_bug: [ OK ] 4.19 sec. 2026-03-09 10:31:08 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.43 sec. 2026-03-09 10:31:08 01746_extract_text_from_html: [ OK ] 0.67 sec. 2026-03-09 10:31:08 01690_quantilesTiming_ubsan: [ OK ] 0.42 sec. 2026-03-09 10:31:09 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.42 sec. 2026-03-09 10:31:09 00612_count: [ OK ] 0.72 sec. 2026-03-09 10:31:09 01658_values_ubsan: [ OK ] 0.53 sec. 2026-03-09 10:31:09 03003_count_asterisk_filter: [ OK ] 0.52 sec. 2026-03-09 10:31:09 02871_join_on_system_errors: [ OK ] 0.47 sec. 2026-03-09 10:31:10 02312_parquet_orc_arrow_names_tuples: [ OK ] 0.62 sec. 2026-03-09 10:31:11 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 0.72 sec. 2026-03-09 10:31:11 02013_bloom_filter_hasAll: [ OK ] 0.72 sec. 2026-03-09 10:31:12 02969_auto_format_detection: [ OK ] 16.23 sec. 2026-03-09 10:31:12 03002_map_array_functions_with_low_cardinality: [ OK ] 0.43 sec. 2026-03-09 10:31:13 02681_undrop_query_uuid: [ OK ] 5.49 sec. 2026-03-09 10:31:13 01280_min_map_max_map: [ OK ] 0.72 sec. 2026-03-09 10:31:13 03156_group_concat: [ OK ] 1.03 sec. 2026-03-09 10:31:14 01781_merge_tree_deduplication: [ OK ] 1.48 sec. 2026-03-09 10:31:15 00517_date_parsing: [ OK ] 0.58 sec. 2026-03-09 10:31:15 01654_test_writer_block_sequence: [ OK ] 15.53 sec. 2026-03-09 10:31:15 01171_mv_select_insert_isolation_long: [ OK ] 152.44 sec. 2026-03-09 10:31:15 02764_csv_trim_whitespaces: [ OK ] 21.30 sec. 2026-03-09 10:31:15 02372_analyzer_join: [ OK ] 6.04 sec. 2026-03-09 10:31:15 01611_string_to_low_cardinality_key_alter: [ OK ] 0.62 sec. 2026-03-09 10:31:15 00969_roundDuration: [ OK ] 0.52 sec. 2026-03-09 10:31:16 00503_cast_const_nullable: [ OK ] 0.47 sec. 2026-03-09 10:31:16 02011_normalize_utf8: [ OK ] 0.72 sec. 2026-03-09 10:31:16 02311_system_zookeeper_insert: [ OK ] 0.77 sec. 2026-03-09 10:31:16 02860_distributed_flush_on_detach: [ OK ] 0.53 sec. 2026-03-09 10:31:16 01913_names_of_tuple_literal: [ OK ] 0.52 sec. 2026-03-09 10:31:17 02375_scalar_lc_cte: [ OK ] 0.42 sec. 2026-03-09 10:31:17 01652_ttl_old_syntax: [ OK ] 0.47 sec. 2026-03-09 10:31:17 00335_bom: [ OK ] 0.93 sec. 2026-03-09 10:31:18 02343_aggregation_pipeline: [ OK ] 0.67 sec. 2026-03-09 10:31:18 02882_formatQuery: [ OK ] 0.77 sec. 2026-03-09 10:31:19 00752_low_cardinality_array_result: [ OK ] 0.47 sec. 2026-03-09 10:31:19 02355_control_block_size_in_array_join: [ OK ] 0.53 sec. 2026-03-09 10:31:19 02250_lots_of_columns_in_csv_with_names: [ OK ] 3.43 sec. 2026-03-09 10:31:19 01715_background_checker_blather_zookeeper_long: [ OK ] 10.76 sec. 2026-03-09 10:31:20 01318_encrypt: [ OK ] 1.18 sec. 2026-03-09 10:31:20 02881_system_detached_parts_modification_time: [ OK ] 0.52 sec. 2026-03-09 10:31:20 00937_test_use_header_csv: [ OK ] 7.25 sec. 2026-03-09 10:31:21 01526_param_uuid: [ OK ] 1.23 sec. 2026-03-09 10:31:21 02158_proportions_ztest_cmp: [ OK ] 2.08 sec. 2026-03-09 10:31:21 02983_empty_map: [ OK ] 0.82 sec. 2026-03-09 10:31:21 01921_with_fill_with_totals: [ OK ] 0.42 sec. 2026-03-09 10:31:22 00980_merge_alter_settings: [ OK ] 0.77 sec. 2026-03-09 10:31:22 01721_join_implicit_cast_long: [ OK ] 7.25 sec. 2026-03-09 10:31:22 00757_enum_defaults_const: [ OK ] 0.47 sec. 2026-03-09 10:31:23 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.47 sec. 2026-03-09 10:31:23 03169_time_virtual_column: [ OK ] 1.98 sec. 2026-03-09 10:31:23 02130_parse_quoted_null: [ OK ] 7.35 sec. 2026-03-09 10:31:23 02923_cte_equality_disjunction: [ OK ] 0.47 sec. 2026-03-09 10:31:23 01060_defaults_all_columns: [ OK ] 0.47 sec. 2026-03-09 10:31:23 01866_bit_positions_to_array: [ OK ] 0.67 sec. 2026-03-09 10:31:23 03165_storage_merge_view_prewhere: [ OK ] 0.62 sec. 2026-03-09 10:31:24 01616_untuple_access_field: [ OK ] 0.42 sec. 2026-03-09 10:31:24 00037_totals_limit: [ OK ] 0.42 sec. 2026-03-09 10:31:24 02970_visible_width_behavior: [ OK ] 0.62 sec. 2026-03-09 10:31:24 01345_array_join_LittleMaverick: [ OK ] 0.52 sec. 2026-03-09 10:31:24 03079_analyzer_numeric_literals_as_column_names: [ OK ] 0.47 sec. 2026-03-09 10:31:24 02915_analyzer_fuzz_2: [ OK ] 0.52 sec. 2026-03-09 10:31:25 00800_low_cardinality_distributed_insert: [ OK ] 0.52 sec. 2026-03-09 10:31:25 01220_scalar_optimization_in_alter: [ OK ] 0.47 sec. 2026-03-09 10:31:25 02022_storage_filelog_one_file: [ OK ] 4.94 sec. 2026-03-09 10:31:25 02382_join_and_filtering_set: [ OK ] 0.62 sec. 2026-03-09 10:31:26 01387_clear_column_default_depends: [ OK ] 0.83 sec. 2026-03-09 10:31:26 02974_analyzer_array_join_subcolumn: [ OK ] 0.63 sec. 2026-03-09 10:31:26 02973_block_number_sparse_serialization_and_mutation: [ OK ] 0.78 sec. 2026-03-09 10:31:26 02476_fix_cast_parser_bug: [ OK ] 0.42 sec. 2026-03-09 10:31:26 01259_combinator_distinct: [ OK ] 0.52 sec. 2026-03-09 10:31:27 00700_decimal_complex_types: [ OK ] 1.83 sec. 2026-03-09 10:31:27 01710_projections_and_duplicate_columms: [ OK ] 0.67 sec. 2026-03-09 10:31:27 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.62 sec. 2026-03-09 10:31:28 02897_alter_partition_parameters: [ OK ] 1.07 sec. 2026-03-09 10:31:28 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 0.77 sec. 2026-03-09 10:31:29 02458_empty_hdfs_url: [ OK ] 0.47 sec. 2026-03-09 10:31:29 01660_join_or_all: [ OK ] 0.98 sec. 2026-03-09 10:31:29 02311_normalize_utf8_constant: [ OK ] 0.43 sec. 2026-03-09 10:31:30 00605_intersections_aggregate_functions: [ OK ] 0.52 sec. 2026-03-09 10:31:30 00443_optimize_final_vertical_merge: [ OK ] 8.75 sec. 2026-03-09 10:31:30 00738_lock_for_inner_table: [ OK ] 3.48 sec. 2026-03-09 10:31:30 00569_parse_date_time_best_effort: [ OK ] 0.47 sec. 2026-03-09 10:31:30 01083_match_zero_byte: [ OK ] 0.52 sec. 2026-03-09 10:31:30 02962_parallel_window_functions_different_partitioning: [ OK ] 0.52 sec. 2026-03-09 10:31:31 03151_dynamic_type_scale_max_types: [ OK ] 0.72 sec. 2026-03-09 10:31:31 01250_fixed_string_comparison: [ OK ] 0.52 sec. 2026-03-09 10:31:32 02990_arrayFold_nullable_lc: [ OK ] 0.67 sec. 2026-03-09 10:31:32 02571_local_desc_abort_on_twitter_json: [ OK ] 1.13 sec. 2026-03-09 10:31:32 01710_projection_with_ast_rewrite_settings: [ OK ] 0.68 sec. 2026-03-09 10:31:33 01509_format_raw_blob: [ OK ] 2.33 sec. 2026-03-09 10:31:33 01097_cyclic_defaults: [ OK ] 0.77 sec. 2026-03-09 10:31:33 01917_system_data_skipping_indices: [ OK ] 0.52 sec. 2026-03-09 10:31:33 01104_distributed_numbers_test: [ OK ] 0.52 sec. 2026-03-09 10:31:34 00460_vertical_and_totals_extremes: [ OK ] 0.47 sec. 2026-03-09 10:31:34 01104_distributed_one_test: [ OK ] 0.62 sec. 2026-03-09 10:31:34 01720_join_implicit_cast: [ OK ] 1.78 sec. 2026-03-09 10:31:34 02933_ephemeral_mv: [ OK ] 0.52 sec. 2026-03-09 10:31:35 01773_min_max_time_system_parts_datetime64: [ OK ] 0.47 sec. 2026-03-09 10:31:35 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 0.52 sec. 2026-03-09 10:31:36 02661_read_from_archive_tar: [ OK ] 15.38 sec. 2026-03-09 10:31:36 01497_alias_on_default_array: [ OK ] 0.53 sec. 2026-03-09 10:31:37 02184_ipv6_cast_test: [ OK ] 0.47 sec. 2026-03-09 10:31:37 01189_create_as_table_as_table_function: [ OK ] 0.42 sec. 2026-03-09 10:31:38 01052_array_reduce_exception: [ OK ] 0.47 sec. 2026-03-09 10:31:38 03013_forbid_attach_table_if_active_replica_already_exists: [ OK ] 2.95 sec. 2026-03-09 10:31:38 02381_client_prints_server_side_time: [ SKIPPED ] 0.00 sec. 2026-03-09 10:31:38 Reason: not running for current build 2026-03-09 10:31:38 02554_invalid_create_view_syntax: [ OK ] 0.43 sec. 2026-03-09 10:31:38 02841_not_ready_set_bug: [ OK ] 4.29 sec. 2026-03-09 10:31:39 00725_join_on_bug_3: [ OK ] 0.59 sec. 2026-03-09 10:31:40 03209_parameterized_view_with_non_literal_params: [ OK ] 1.23 sec. 2026-03-09 10:31:41 00926_adaptive_index_granularity_merge_tree: [ OK ] 2.15 sec. 2026-03-09 10:31:42 02568_json_array_length: [ OK ] 0.53 sec. 2026-03-09 10:31:42 03198_unload_primary_key_outdated: [ OK ] 3.60 sec. 2026-03-09 10:31:42 02935_http_content_type_with_http_headers_progress: [ OK ] 7.57 sec. 2026-03-09 10:31:42 03262_column_sizes_with_dynamic_structure: [ OK ] 2.30 sec. 2026-03-09 10:31:42 01276_system_licenses: [ OK ] 0.48 sec. 2026-03-09 10:31:43 01451_replicated_detach_drop_and_quorum_long: [ OK ] 0.77 sec. 2026-03-09 10:31:43 00719_parallel_ddl_db: [ OK ] 30.91 sec. 2026-03-09 10:31:44 02669_alter_modify_to_nullable: [ OK ] 1.59 sec. 2026-03-09 10:31:44 02000_table_function_cluster_macros: [ OK ] 0.52 sec. 2026-03-09 10:31:44 02473_multistep_prewhere: [ OK ] 21.92 sec. 2026-03-09 10:31:45 00258_materializing_tuples: [ OK ] 0.47 sec. 2026-03-09 10:31:45 00440_nulls_merge_tree: [ OK ] 0.52 sec. 2026-03-09 10:31:45 03148_async_queries_in_query_log_errors: [ OK ] 3.75 sec. 2026-03-09 10:31:45 00652_replicated_mutations_default_database_zookeeper: [ OK ] 2.59 sec. 2026-03-09 10:31:46 00799_function_dry_run: [ OK ] 0.52 sec. 2026-03-09 10:31:46 02269_to_start_of_interval_overflow: [ OK ] 0.52 sec. 2026-03-09 10:31:47 01202_array_auc_special: [ OK ] 0.63 sec. 2026-03-09 10:31:47 02482_execute_functions_before_sorting_bug: [ OK ] 0.48 sec. 2026-03-09 10:31:48 02421_type_json_async_insert: [ OK ] 4.14 sec. 2026-03-09 10:31:48 03161_ipv4_ipv6_equality: [ OK ] 0.47 sec. 2026-03-09 10:31:48 02915_lazy_loading_of_base_backups: [ OK ] 5.99 sec. 2026-03-09 10:31:49 03205_json_syntax: [ OK ] 0.68 sec. 2026-03-09 10:31:49 01655_plan_optimizations: [ OK ] 20.16 sec. 2026-03-09 10:31:49 01116_asof_join_dolbyzerr: [ OK ] 0.52 sec. 2026-03-09 10:31:49 02864_statistics_ddl: [ OK ] 2.13 sec. 2026-03-09 10:31:49 01040_h3_get_resolution: [ OK ] 0.42 sec. 2026-03-09 10:31:50 02579_fill_empty_chunk_analyzer: [ OK ] 0.47 sec. 2026-03-09 10:31:50 02233_interpolate_1: [ OK ] 0.92 sec. 2026-03-09 10:31:50 02131_skip_index_not_materialized: [ OK ] 0.48 sec. 2026-03-09 10:31:51 01710_projections_order_by_complete: [ OK ] 0.52 sec. 2026-03-09 10:31:51 01825_new_type_json_11: [ OK ] 5.29 sec. 2026-03-09 10:31:51 00520_http_nullable: [ OK ] 0.87 sec. 2026-03-09 10:31:51 01010_partial_merge_join: [ OK ] 2.08 sec. 2026-03-09 10:31:52 01592_length_map: [ OK ] 0.47 sec. 2026-03-09 10:31:52 02861_join_on_nullsafe_compare: [ OK ] 1.28 sec. 2026-03-09 10:31:52 02002_row_level_filter_bug: [ OK ] 7.45 sec. 2026-03-09 10:31:52 01825_type_json_18: [ OK ] 0.52 sec. 2026-03-09 10:31:52 03208_inconsistent_formatting_of_not_subquery: [ OK ] 0.73 sec. 2026-03-09 10:31:53 02543_alter_update_rename_stuck: [ OK ] 6.94 sec. 2026-03-09 10:31:53 02875_show_functions: [ OK ] 2.03 sec. 2026-03-09 10:31:53 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 0.68 sec. 2026-03-09 10:31:53 02477_age_date32: [ OK ] 1.03 sec. 2026-03-09 10:31:53 00293_shard_max_subquery_depth: [ OK ] 0.52 sec. 2026-03-09 10:31:53 02577_keepermap_delete_update: [ OK ] 0.67 sec. 2026-03-09 10:31:53 01935_parametrized_query_parametric_aggregate_function: [ OK ] 0.82 sec. 2026-03-09 10:31:54 03261_json_hints_types_check: [ OK ] 0.67 sec. 2026-03-09 10:31:54 02245_make_datetime64: [ OK ] 1.02 sec. 2026-03-09 10:31:54 01085_simdjson_uint64: [ OK ] 0.47 sec. 2026-03-09 10:31:54 01834_alias_columns_laziness_filimonov: [ OK ] 2.13 sec. 2026-03-09 10:31:55 01626_cnf_test: [ OK ] 0.53 sec. 2026-03-09 10:31:55 01825_type_json_in_array: [ OK ] 0.67 sec. 2026-03-09 10:31:55 02149_issue_32487: [ OK ] 0.47 sec. 2026-03-09 10:31:55 00632_aggregation_window_funnel: [ OK ] 1.93 sec. 2026-03-09 10:31:55 01580_column_const_comparision: [ OK ] 0.42 sec. 2026-03-09 10:31:56 02012_changed_enum_type_non_replicated: [ OK ] 0.58 sec. 2026-03-09 10:31:56 02265_per_table_ttl_mutation_on_change: [ OK ] 0.87 sec. 2026-03-09 10:31:57 00932_array_intersect_bug: [ OK ] 0.48 sec. 2026-03-09 10:31:57 02456_bloom_filter_assert: [ OK ] 0.87 sec. 2026-03-09 10:31:57 02886_missed_json_subcolumns: [ OK ] 0.63 sec. 2026-03-09 10:31:58 02421_truncate_isolation_no_merges: [ OK ] 32.76 sec. 2026-03-09 10:31:59 00069_date_arithmetic: [ OK ] 0.57 sec. 2026-03-09 10:31:59 01445_create_table_as_table_function: [ OK ] 1.83 sec. 2026-03-09 10:31:59 03038_nested_dynamic_merges_wide_vertical: [ OK ] 4.29 sec. 2026-03-09 10:31:59 01545_url_file_format_settings: [ OK ] 0.52 sec. 2026-03-09 10:32:00 03291_json_big_structure_deserialization: [ OK ] 6.44 sec. 2026-03-09 10:32:00 02115_map_contains_analyzer: [ OK ] 0.48 sec. 2026-03-09 10:32:00 02231_hierarchical_dictionaries_constant: [ OK ] 0.68 sec. 2026-03-09 10:32:00 00231_format_vertical_raw: [ OK ] 0.42 sec. 2026-03-09 10:32:01 00938_dataset_test: [ OK ] 0.52 sec. 2026-03-09 10:32:01 03053_analyzer_join_alias: [ OK ] 0.53 sec. 2026-03-09 10:32:02 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.53 sec. 2026-03-09 10:32:03 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 0.97 sec. 2026-03-09 10:32:04 01825_type_json_8: [ OK ] 4.29 sec. 2026-03-09 10:32:04 00647_histogram: [ OK ] 0.53 sec. 2026-03-09 10:32:04 01351_geohash_assert: [ OK ] 0.42 sec. 2026-03-09 10:32:05 01018_ambiguous_column: [ OK ] 0.52 sec. 2026-03-09 10:32:05 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.47 sec. 2026-03-09 10:32:06 00676_group_by_in: [ OK ] 0.52 sec. 2026-03-09 10:32:06 03007_column_nullable_uninitialzed_value: [ OK ] 0.42 sec. 2026-03-09 10:32:07 01558_enum_as_num_in_tsv_csv_input: [ OK ] 0.57 sec. 2026-03-09 10:32:07 02015_async_inserts_4: [ OK ] 7.40 sec. 2026-03-09 10:32:08 02487_create_index_normalize_functions: [ OK ] 0.57 sec. 2026-03-09 10:32:09 02294_floating_point_second_in_settings: [ OK ] 5.04 sec. 2026-03-09 10:32:09 01922_sum_null_for_remote: [ OK ] 0.47 sec. 2026-03-09 10:32:09 00909_kill_not_initialized_query: [ OK ] 9.20 sec. 2026-03-09 10:32:10 02354_tuple_element_with_default: [ OK ] 0.57 sec. 2026-03-09 10:32:10 01651_lc_insert_tiny_log_1: [ OK ] 3.08 sec. 2026-03-09 10:32:10 02784_projections_read_in_order_bug: [ OK ] 0.68 sec. 2026-03-09 10:32:11 02013_zlib_read_after_eof: [ OK ] 2.83 sec. 2026-03-09 10:32:11 00577_full_join_segfault: [ OK ] 0.47 sec. 2026-03-09 10:32:12 03172_dynamic_binary_serialization: [ OK ] 22.75 sec. 2026-03-09 10:32:12 02366_kql_func_ip: [ OK ] 2.23 sec. 2026-03-09 10:32:12 00835_if_generic_case: [ OK ] 0.57 sec. 2026-03-09 10:32:13 02586_generate_random_structure: [ OK ] 0.67 sec. 2026-03-09 10:32:13 03006_async_insert_deadlock_log: [ OK ] 2.28 sec. 2026-03-09 10:32:13 00905_compile_expressions_compare_big_dates: [ OK ] 0.53 sec. 2026-03-09 10:32:14 02016_bit_shift_right_for_string_integer: [ OK ] 1.33 sec. 2026-03-09 10:32:14 00421_storage_merge__table_index: [ OK ] 19.24 sec. 2026-03-09 10:32:14 03199_merge_filters_bug: [ OK ] 0.62 sec. 2026-03-09 10:32:14 02692_multiple_joins_unicode: [ OK ] 0.62 sec. 2026-03-09 10:32:15 02538_alter_rename_sequence: [ OK ] 0.87 sec. 2026-03-09 10:32:15 01548_create_table_compound_column_format: [ OK ] 0.87 sec. 2026-03-09 10:32:16 02345_filesystem_local: [ OK ] 0.98 sec. 2026-03-09 10:32:16 00900_orc_arrow_parquet_maps: [ OK ] 6.80 sec. 2026-03-09 10:32:16 02906_flatten_only_true_nested: [ OK ] 0.47 sec. 2026-03-09 10:32:17 01302_polygons_distance: [ OK ] 0.57 sec. 2026-03-09 10:32:17 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 3.88 sec. 2026-03-09 10:32:17 02246_flatten_tuple: [ OK ] 0.52 sec. 2026-03-09 10:32:17 02026_accurate_cast_or_default: [ OK ] 0.77 sec. 2026-03-09 10:32:18 01453_normalize_query_alias_uuid: [ OK ] 0.42 sec. 2026-03-09 10:32:18 00387_use_client_time_zone: [ OK ] 1.18 sec. 2026-03-09 10:32:18 02473_multistep_split_prewhere: [ OK ] 21.30 sec. 2026-03-09 10:32:19 01451_replicated_detach_drop_part_long: [ OK ] 0.82 sec. 2026-03-09 10:32:19 01558_transform_null_in: [ OK ] 0.62 sec. 2026-03-09 10:32:19 02165_h3_num_hexagons: [ OK ] 0.58 sec. 2026-03-09 10:32:20 03207_json_read_subcolumns_1_compact_merge_tree: [ OK ] 4.49 sec. 2026-03-09 10:32:20 02122_parallel_formatting_Values: [ OK ] 2.88 sec. 2026-03-09 10:32:20 01880_remote_ipv6: [ OK ] 0.63 sec. 2026-03-09 10:32:20 02421_truncate_isolation_with_mutations: [ OK ] 28.12 sec. 2026-03-09 10:32:20 02807_lower_utf8_msan: [ OK ] 0.42 sec. 2026-03-09 10:32:21 01681_bloom_filter_nullable_column: [ OK ] 0.77 sec. 2026-03-09 10:32:21 00118_storage_join: [ OK ] 0.57 sec. 2026-03-09 10:32:21 01506_buffer_table_alter_block_structure: [ OK ] 0.57 sec. 2026-03-09 10:32:21 02122_parallel_formatting_Pretty: [ OK ] 6.95 sec. 2026-03-09 10:32:21 02501_analyzer_expired_context_crash_fix: [ OK ] 0.52 sec. 2026-03-09 10:32:21 03149_variant_pop_back_typo: [ OK ] 0.42 sec. 2026-03-09 10:32:21 01355_alter_column_with_order: [ OK ] 0.62 sec. 2026-03-09 10:32:22 01529_union_distinct_and_setting_union_default_mode: [ OK ] 0.82 sec. 2026-03-09 10:32:22 00550_join_insert_select: [ OK ] 1.73 sec. 2026-03-09 10:32:22 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.57 sec. 2026-03-09 10:32:22 00337_shard_any_heavy: [ OK ] 0.48 sec. 2026-03-09 10:32:23 02531_ipv4_arithmetic: [ OK ] 0.42 sec. 2026-03-09 10:32:23 02875_parallel_replicas_remote: [ OK ] 0.98 sec. 2026-03-09 10:32:23 01014_count_of_merges_metrics: [ OK ] 0.53 sec. 2026-03-09 10:32:23 00955_complex_prepared_statements: [ OK ] 5.19 sec. 2026-03-09 10:32:23 01540_verbatim_partition_pruning: [ OK ] 0.72 sec. 2026-03-09 10:32:24 02494_array_function_range: [ OK ] 0.53 sec. 2026-03-09 10:32:24 03150_grouping_sets_use_nulls_pushdown: [ OK ] 0.58 sec. 2026-03-09 10:32:24 02959_system_database_engines: [ OK ] 0.42 sec. 2026-03-09 10:32:24 01854_HTTP_dict_decompression: [ OK ] 1.53 sec. 2026-03-09 10:32:25 01053_drop_database_mat_view: [ OK ] 0.57 sec. 2026-03-09 10:32:25 02751_text_formats_bad_nullable_parsing: [ OK ] 3.84 sec. 2026-03-09 10:32:25 00514_interval_operators: [ OK ] 0.72 sec. 2026-03-09 10:32:26 00851_http_insert_json_defaults: [ OK ] 2.38 sec. 2026-03-09 10:32:26 00872_t64_bit_codec: [ OK ] 2.08 sec. 2026-03-09 10:32:26 02933_replicated_database_forbid_create_as_select: [ OK ] 5.14 sec. 2026-03-09 10:32:26 01499_log_deadlock: [ OK ] 0.58 sec. 2026-03-09 10:32:26 01338_long_select_and_alter_zookeeper: [ OK ] 14.67 sec. 2026-03-09 10:32:27 01293_external_sorting_limit_bug: [ OK ] 0.52 sec. 2026-03-09 10:32:27 02246_clickhouse_local_drop_database: [ OK ] 1.43 sec. 2026-03-09 10:32:27 02381_arrow_dict_to_lc: [ OK ] 1.03 sec. 2026-03-09 10:32:27 02515_analyzer_null_for_empty: [ OK ] 0.42 sec. 2026-03-09 10:32:27 00849_multiple_comma_join_2: [ OK ] 1.22 sec. 2026-03-09 10:32:27 00552_logical_functions_simple: [ OK ] 0.47 sec. 2026-03-09 10:32:27 01421_array_nullable_element_nullable_index: [ OK ] 0.47 sec. 2026-03-09 10:32:28 00338_replicate_array_of_strings: [ OK ] 0.52 sec. 2026-03-09 10:32:28 02179_bool_type: [ OK ] 0.62 sec. 2026-03-09 10:32:28 00698_validate_array_sizes_for_nested: [ OK ] 0.47 sec. 2026-03-09 10:32:28 02207_s3_content_type: [ OK ] 1.83 sec. 2026-03-09 10:32:28 02933_compare_with_bool_as_string: [ OK ] 0.42 sec. 2026-03-09 10:32:28 02430_initialize_aggregation_with_combinators: [ OK ] 0.42 sec. 2026-03-09 10:32:29 00757_enum_defaults_const_analyzer: [ OK ] 0.42 sec. 2026-03-09 10:32:29 02560_regexp_denial_of_service: [ OK ] 1.03 sec. 2026-03-09 10:32:29 03130_convert_outer_join_to_inner_join: [ OK ] 0.62 sec. 2026-03-09 10:32:29 01656_sequence_next_node_long: [ OK ] 3.64 sec. 2026-03-09 10:32:30 01249_flush_interactive: [ OK ] 10.86 sec. 2026-03-09 10:32:34 02457_csv_parse_date_out_of_range: [ OK ] 6.59 sec. 2026-03-09 10:32:34 01490_nullable_string_to_enum: [ OK ] 4.69 sec. 2026-03-09 10:32:35 01276_random_string: [ OK ] 5.44 sec. 2026-03-09 10:32:35 00497_whitespaces_in_insert: [ OK ] 10.71 sec. 2026-03-09 10:32:36 00180_attach_materialized_view: [ OK ] 1.68 sec. 2026-03-09 10:32:36 00913_many_threads: [ OK ] 7.14 sec. 2026-03-09 10:32:36 00988_constraints_replication_zookeeper_long: [ OK ] 2.13 sec. 2026-03-09 10:32:36 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.48 sec. 2026-03-09 10:32:36 02733_sparse_columns_reload: [ OK ] 0.99 sec. 2026-03-09 10:32:36 01303_polygons_equals: [ OK ] 0.42 sec. 2026-03-09 10:32:37 02890_untuple_column_names: [ OK ] 0.62 sec. 2026-03-09 10:32:37 00059_shard_global_in_mergetree: [ OK ] 1.03 sec. 2026-03-09 10:32:37 02380_analyzer_join_sample: [ OK ] 0.77 sec. 2026-03-09 10:32:37 01938_joins_identifiers: [ OK ] 0.52 sec. 2026-03-09 10:32:37 01710_projection_in_set: [ OK ] 0.72 sec. 2026-03-09 10:32:37 01080_window_view_inner_table_memory_hop: [ OK ] 9.05 sec. 2026-03-09 10:32:37 01715_table_function_view_fix: [ OK ] 0.47 sec. 2026-03-09 10:32:37 00715_bounding_ratio_merge_empty: [ OK ] 0.57 sec. 2026-03-09 10:32:37 03199_fix_auc_tie_handling: [ OK ] 0.52 sec. 2026-03-09 10:32:37 02842_suggest_http_page_in_error_message: [ OK ] 0.77 sec. 2026-03-09 10:32:38 01641_memory_tracking_insert_optimize: [ OK ] 0.93 sec. 2026-03-09 10:32:38 02315_pmj_union_ubsan_35857: [ OK ] 0.47 sec. 2026-03-09 10:32:38 01825_new_type_json_18: [ OK ] 0.63 sec. 2026-03-09 10:32:38 03084_analyzer_join_column_alias: [ OK ] 0.47 sec. 2026-03-09 10:32:38 02769_compare_functions_nan: [ OK ] 0.72 sec. 2026-03-09 10:32:38 02908_filesystem_cache_as_collection: [ OK ] 0.47 sec. 2026-03-09 10:32:38 02174_cte_scalar_cache_mv: [ OK ] 9.55 sec. 2026-03-09 10:32:38 02706_kolmogorov_smirnov_test: [ OK ] 0.67 sec. 2026-03-09 10:32:39 00136_duplicate_order_by_elems: [ OK ] 0.52 sec. 2026-03-09 10:32:39 02845_domain_rfc_support_ipv6: [ OK ] 0.67 sec. 2026-03-09 10:32:39 00968_roundAge: [ OK ] 0.52 sec. 2026-03-09 10:32:39 01116_cross_count_asterisks: [ OK ] 0.42 sec. 2026-03-09 10:32:39 00053_all_inner_join: [ OK ] 0.47 sec. 2026-03-09 10:32:39 01561_aggregate_functions_of_key_with_join: [ OK ] 0.42 sec. 2026-03-09 10:32:39 01043_h3_edge_length_m: [ OK ] 0.47 sec. 2026-03-09 10:32:39 00362_great_circle_distance: [ OK ] 0.47 sec. 2026-03-09 10:32:39 02969_archive_seek: [ OK ] 1.02 sec. 2026-03-09 10:32:39 01280_null_in: [ OK ] 0.52 sec. 2026-03-09 10:32:39 02381_parse_array_of_tuples: [ OK ] 0.47 sec. 2026-03-09 10:32:40 01851_s2_to_geo: [ OK ] 0.47 sec. 2026-03-09 10:32:40 02724_persist_interval_type: [ OK ] 0.62 sec. 2026-03-09 10:32:40 01710_projection_optimize_materialize: [ OK ] 0.92 sec. 2026-03-09 10:32:40 01214_test_storage_merge_aliases_with_where: [ OK ] 0.72 sec. 2026-03-09 10:32:40 00151_tuple_with_array: [ OK ] 0.47 sec. 2026-03-09 10:32:40 01852_s2_get_neighbours: [ OK ] 0.42 sec. 2026-03-09 10:32:40 01835_alias_to_primary_key_cyfdecyf: [ OK ] 0.58 sec. 2026-03-09 10:32:40 02999_scalar_subqueries_bug_1: [ OK ] 0.58 sec. 2026-03-09 10:32:41 02874_analysis_of_variance_overflow: [ OK ] 0.47 sec. 2026-03-09 10:32:41 00702_join_on_dups: [ OK ] 1.18 sec. 2026-03-09 10:32:41 02366_kql_native_interval_format: [ OK ] 0.52 sec. 2026-03-09 10:32:41 00742_require_join_strictness: [ OK ] 0.52 sec. 2026-03-09 10:32:41 02412_nlp: [ OK ] 0.52 sec. 2026-03-09 10:32:41 02324_compatibility_setting: [ OK ] 4.09 sec. 2026-03-09 10:32:41 01020_function_array_compact: [ OK ] 0.58 sec. 2026-03-09 10:32:41 01946_profile_sleep: [ OK ] 1.78 sec. 2026-03-09 10:32:41 00320_between: [ OK ] 0.47 sec. 2026-03-09 10:32:41 01817_storage_buffer_parameters: [ OK ] 0.62 sec. 2026-03-09 10:32:42 01670_log_comment: [ OK ] 0.67 sec. 2026-03-09 10:32:42 02470_suspicious_low_cardinality_msan: [ OK ] 0.57 sec. 2026-03-09 10:32:42 02994_merge_tree_mutations_cleanup: [ OK ] 12.97 sec. 2026-03-09 10:32:42 00974_low_cardinality_cast: [ OK ] 0.62 sec. 2026-03-09 10:32:42 02969_functions_to_subcolumns_if_null: [ OK ] 0.72 sec. 2026-03-09 10:32:42 01710_normal_projection_with_query_plan_optimization: [ OK ] 0.62 sec. 2026-03-09 10:32:42 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 0.82 sec. 2026-03-09 10:32:42 02916_distributed_skip_unavailable_shards: [ OK ] 0.53 sec. 2026-03-09 10:32:42 01795_TinyLog_rwlock_ub: [ OK ] 0.52 sec. 2026-03-09 10:32:42 02923_join_use_nulls_modulo: [ OK ] 0.47 sec. 2026-03-09 10:32:43 01518_nullable_aggregate_states1: [ OK ] 0.63 sec. 2026-03-09 10:32:43 02813_any_value: [ OK ] 0.47 sec. 2026-03-09 10:32:43 02243_ipv6_long_parsing: [ OK ] 0.48 sec. 2026-03-09 10:32:43 01668_avg_weighted_ubsan: [ OK ] 0.47 sec. 2026-03-09 10:32:43 01075_allowed_client_hosts: [ OK ] 0.53 sec. 2026-03-09 10:32:43 02520_group_array_last: [ OK ] 0.83 sec. 2026-03-09 10:32:43 03113_analyzer_not_found_column_in_block_2: [ OK ] 0.47 sec. 2026-03-09 10:32:43 02515_tuple_lambda_parsing: [ OK ] 0.42 sec. 2026-03-09 10:32:43 01433_hex_float: [ OK ] 0.48 sec. 2026-03-09 10:32:43 02045_like_function: [ OK ] 0.47 sec. 2026-03-09 10:32:44 02242_make_date_mysql: [ OK ] 0.82 sec. 2026-03-09 10:32:44 01942_dateTimeToSnowflake: [ OK ] 0.68 sec. 2026-03-09 10:32:44 01825_new_type_json_distributed: [ OK ] 0.57 sec. 2026-03-09 10:32:44 00622_select_in_parens: [ OK ] 0.47 sec. 2026-03-09 10:32:44 00752_low_cardinality_left_array_join: [ OK ] 0.52 sec. 2026-03-09 10:32:44 01273_h3EdgeAngle_range_check: [ OK ] 0.42 sec. 2026-03-09 10:32:44 02361_fsync_profile_events: [ OK ] 2.28 sec. 2026-03-09 10:32:44 01776_decrypt_aead_size_check: [ OK ] 0.52 sec. 2026-03-09 10:32:44 02131_row_policies_combination: [ OK ] 0.67 sec. 2026-03-09 10:32:45 00875_join_right_nulls: [ OK ] 0.77 sec. 2026-03-09 10:32:45 01825_type_json_13: [ OK ] 3.53 sec. 2026-03-09 10:32:45 03203_variant_convert_field_to_type_bug: [ OK ] 0.52 sec. 2026-03-09 10:32:45 02713_sequence_match_serialization_fix: [ OK ] 0.52 sec. 2026-03-09 10:32:45 02956_clickhouse_local_system_parts: [ OK ] 1.12 sec. 2026-03-09 10:32:45 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.47 sec. 2026-03-09 10:32:45 02493_max_streams_for_merge_tree_reading: [ OK ] 1.68 sec. 2026-03-09 10:32:46 03005_input_function_in_join: [ OK ] 0.52 sec. 2026-03-09 10:32:46 02489_analyzer_indexes: [ OK ] 0.82 sec. 2026-03-09 10:32:46 01196_max_parser_depth: [ OK ] 1.43 sec. 2026-03-09 10:32:46 00639_startsWith: [ OK ] 0.52 sec. 2026-03-09 10:32:46 01050_engine_join_crash: [ OK ] 0.68 sec. 2026-03-09 10:32:46 02122_parallel_formatting_Vertical: [ OK ] 3.53 sec. 2026-03-09 10:32:46 02324_map_combinator_bug: [ OK ] 0.52 sec. 2026-03-09 10:32:46 00927_asof_join_noninclusive: [ OK ] 0.62 sec. 2026-03-09 10:32:47 03004_force_null_for_omitted: [ OK ] 0.77 sec. 2026-03-09 10:32:47 02375_pretty_formats: [ OK ] 0.57 sec. 2026-03-09 10:32:47 00668_compare_arrays_silviucpp: [ OK ] 0.47 sec. 2026-03-09 10:32:47 02481_default_value_used_in_row_level_filter: [ OK ] 0.52 sec. 2026-03-09 10:32:47 02982_comments_in_system_tables: [ OK ] 1.23 sec. 2026-03-09 10:32:47 00825_protobuf_format_skipped_column_in_nested: [ OK ] 2.73 sec. 2026-03-09 10:32:47 01300_group_by_other_keys_having: [ OK ] 1.53 sec. 2026-03-09 10:32:47 01521_alter_enum_and_reverse_read: [ OK ] 0.52 sec. 2026-03-09 10:32:47 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 0.47 sec. 2026-03-09 10:32:47 01292_quantile_array_bug: [ OK ] 0.43 sec. 2026-03-09 10:32:47 00853_join_with_nulls_crash: [ OK ] 0.62 sec. 2026-03-09 10:32:48 01018_ddl_dictionaries_select: [ OK ] 1.07 sec. 2026-03-09 10:32:48 02030_function_mapContainsKeyLike: [ OK ] 0.53 sec. 2026-03-09 10:32:48 02148_cast_type_parsing: [ OK ] 0.42 sec. 2026-03-09 10:32:48 01380_nullable_state: [ OK ] 0.82 sec. 2026-03-09 10:32:48 02293_grouping_function_group_by: [ OK ] 0.88 sec. 2026-03-09 10:32:48 03206_is_null_constant_result_old_analyzer_bug: [ OK ] 0.52 sec. 2026-03-09 10:32:48 01283_strict_resize_bug: [ OK ] 1.22 sec. 2026-03-09 10:32:48 03217_primary_index_memory_leak: [ SKIPPED ] 0.00 sec. 2026-03-09 10:32:48 Reason: not running for current build 2026-03-09 10:32:48 02815_first_line: [ OK ] 0.52 sec. 2026-03-09 10:32:48 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.42 sec. 2026-03-09 10:32:48 02340_analyzer_functions: [ OK ] 0.52 sec. 2026-03-09 10:32:49 02888_obsolete_settings: [ OK ] 0.52 sec. 2026-03-09 10:32:49 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.47 sec. 2026-03-09 10:32:49 01011_test_create_as_skip_indices: [ OK ] 0.47 sec. 2026-03-09 10:32:49 01012_select_limit_x_0: [ OK ] 0.47 sec. 2026-03-09 10:32:49 02421_json_decimals_as_strings: [ OK ] 0.47 sec. 2026-03-09 10:32:49 02887_format_readable_timedelta_subseconds: [ OK ] 0.57 sec. 2026-03-09 10:32:49 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.42 sec. 2026-03-09 10:32:50 01458_count_digits: [ OK ] 0.52 sec. 2026-03-09 10:32:50 03002_modify_query_cte: [ OK ] 0.37 sec. 2026-03-09 10:32:50 00185_array_literals: [ OK ] 0.52 sec. 2026-03-09 10:32:50 02192_comment_error: [ OK ] 2.13 sec. 2026-03-09 10:32:50 02842_table_function_file_filter_by_virtual_columns: [ OK ] 1.12 sec. 2026-03-09 10:32:50 02962_join_using_bug_57894: [ OK ] 0.52 sec. 2026-03-09 10:32:50 02684_bson: [ OK ] 0.42 sec. 2026-03-09 10:32:50 01425_default_value_of_type_name: [ OK ] 0.42 sec. 2026-03-09 10:32:50 03062_analyzer_join_engine_missing_column: [ OK ] 0.47 sec. 2026-03-09 10:32:51 02360_send_logs_level_colors: [ OK ] 1.93 sec. 2026-03-09 10:32:51 00218_like_regexp_newline: [ OK ] 0.47 sec. 2026-03-09 10:32:51 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.57 sec. 2026-03-09 10:32:51 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 0.72 sec. 2026-03-09 10:32:51 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.52 sec. 2026-03-09 10:32:51 03143_parallel_replicas_mat_view_bug: [ OK ] 0.58 sec. 2026-03-09 10:32:52 00405_output_format_pretty_color: [ OK ] 0.77 sec. 2026-03-09 10:32:52 02457_parse_date_time_best_effort: [ OK ] 0.67 sec. 2026-03-09 10:32:52 03199_join_with_materialized_column: [ OK ] 0.42 sec. 2026-03-09 10:32:53 00411_merge_tree_where_const_in_set: [ OK ] 0.52 sec. 2026-03-09 10:32:53 01945_system_warnings: [ OK ] 3.08 sec. 2026-03-09 10:32:53 01507_transform_null_in: [ OK ] 0.47 sec. 2026-03-09 10:32:53 02734_sparse_columns_mutation: [ OK ] 0.68 sec. 2026-03-09 10:32:53 02122_parallel_formatting_Markdown: [ OK ] 2.88 sec. 2026-03-09 10:32:54 01470_columns_transformers: [ OK ] 0.87 sec. 2026-03-09 10:32:54 02183_dictionary_date_types: [ OK ] 1.13 sec. 2026-03-09 10:32:54 02560_tuple_format: [ OK ] 1.08 sec. 2026-03-09 10:32:55 00804_test_alter_compression_codecs: [ OK ] 6.69 sec. 2026-03-09 10:32:55 01070_h3_to_parent: [ OK ] 0.47 sec. 2026-03-09 10:32:55 00952_insert_into_distributed_with_materialized_column: [ OK ] 0.93 sec. 2026-03-09 10:32:55 02784_schema_inference_null_as_default: [ OK ] 0.42 sec. 2026-03-09 10:32:56 01576_alter_low_cardinality_and_select: [ OK ] 4.59 sec. 2026-03-09 10:32:56 02564_read_in_order_final_desc: [ OK ] 0.58 sec. 2026-03-09 10:32:56 02456_keeper_retries_during_insert: [ OK ] 2.03 sec. 2026-03-09 10:32:57 02941_projections_external_aggregation: [ OK ] 1.43 sec. 2026-03-09 10:32:57 00978_ml_math: [ OK ] 0.42 sec. 2026-03-09 10:32:57 01284_escape_sequences_php_mysql_style: [ OK ] 0.53 sec. 2026-03-09 10:32:57 03033_tupleIntXYZ_and_tupleModulo: [ OK ] 0.87 sec. 2026-03-09 10:32:58 02383_arrow_dict_special_cases: [ OK ] 4.89 sec. 2026-03-09 10:32:58 00050_any_left_join: [ OK ] 0.42 sec. 2026-03-09 10:32:58 01072_json_each_row_data_in_square_brackets: [ OK ] 0.52 sec. 2026-03-09 10:32:58 00751_low_cardinality_nullable_group_by: [ OK ] 1.27 sec. 2026-03-09 10:32:59 01514_parallel_formatting: [ OK ] 2.08 sec. 2026-03-09 10:32:59 02346_fulltext_index_bug47393: [ OK ] 0.57 sec. 2026-03-09 10:32:59 02243_make_date32: [ OK ] 1.07 sec. 2026-03-09 10:33:00 01417_update_permutation_crash: [ OK ] 0.42 sec. 2026-03-09 10:33:00 02129_add_column_add_ttl: [ OK ] 0.73 sec. 2026-03-09 10:33:00 01825_type_json_empty_string: [ OK ] 0.42 sec. 2026-03-09 10:33:00 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec. 2026-03-09 10:33:00 Reason: not running for current build 2026-03-09 10:33:01 01889_clickhouse_client_config_format: [ OK ] 2.43 sec. 2026-03-09 10:33:01 01538_fuzz_aggregate: [ OK ] 0.47 sec. 2026-03-09 10:33:01 01182_materialized_view_different_structure: [ OK ] 0.82 sec. 2026-03-09 10:33:02 01544_fromModifiedJulianDay: [ OK ] 0.67 sec. 2026-03-09 10:33:02 00152_totals_in_subquery: [ OK ] 0.42 sec. 2026-03-09 10:33:02 01000_unneeded_substitutions_client: [ OK ] 1.18 sec. 2026-03-09 10:33:03 00758_array_reverse: [ OK ] 0.62 sec. 2026-03-09 10:33:03 02496_remove_redundant_sorting: [ OK ] 16.33 sec. 2026-03-09 10:33:03 02551_obfuscator_keywords: [ OK ] 0.93 sec. 2026-03-09 10:33:03 02134_async_inserts_formats: [ OK ] 7.85 sec. 2026-03-09 10:33:03 02522_different_types_in_storage_merge: [ OK ] 0.53 sec. 2026-03-09 10:33:04 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.57 sec. 2026-03-09 10:33:04 02500_analyzer_storage_view_crash_fix: [ OK ] 0.62 sec. 2026-03-09 10:33:04 00104_totals_having_mode: [ OK ] 0.57 sec. 2026-03-09 10:33:04 02345_analyzer_subqueries: [ OK ] 0.73 sec. 2026-03-09 10:33:04 02071_lower_upper_utf8_row_overlaps: [ OK ] 0.52 sec. 2026-03-09 10:33:04 03144_asof_join_ddb_doubles: [ OK ] 0.52 sec. 2026-03-09 10:33:05 00129_quantile_timing_weighted: [ OK ] 0.47 sec. 2026-03-09 10:33:05 01281_sum_nullable: [ OK ] 0.53 sec. 2026-03-09 10:33:05 01891_partition_by_uuid: [ OK ] 0.47 sec. 2026-03-09 10:33:05 03152_join_filter_push_down_equivalent_columns: [ OK ] 0.63 sec. 2026-03-09 10:33:06 02556_local_with_totals_and_extremes: [ OK ] 0.92 sec. 2026-03-09 10:33:06 03013_ignore_drop_queries_probability: [ OK ] 0.57 sec. 2026-03-09 10:33:06 02876_yyyymmddtodate: [ OK ] 1.42 sec. 2026-03-09 10:33:06 03036_dynamic_read_shared_subcolumns_memory: [ OK ] 15.73 sec. 2026-03-09 10:33:07 00688_low_cardinality_syntax: [ OK ] 0.73 sec. 2026-03-09 10:33:07 01043_categorical_iv: [ OK ] 0.67 sec. 2026-03-09 10:33:07 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 3.08 sec. 2026-03-09 10:33:07 01198_client_quota_key: [ OK ] 1.63 sec. 2026-03-09 10:33:07 00976_system_stop_ttl_merges: [ OK ] 1.63 sec. 2026-03-09 10:33:08 01560_optimize_on_insert_zookeeper: [ OK ] 0.72 sec. 2026-03-09 10:33:08 02125_lz4_compression_bug_CSV: [ OK ] 7.30 sec. 2026-03-09 10:33:08 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.47 sec. 2026-03-09 10:33:08 01017_in_unconvertible_complex_type: [ OK ] 0.52 sec. 2026-03-09 10:33:08 03209_json_type_vertical_merges: [ SKIPPED ] 0.00 sec. 2026-03-09 10:33:08 Reason: not running for current build 2026-03-09 10:33:08 03230_subcolumns_mv: [ OK ] 0.57 sec. 2026-03-09 10:33:08 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 0.58 sec. 2026-03-09 10:33:08 00910_crash_when_distributed_modify_order_by: [ OK ] 0.52 sec. 2026-03-09 10:33:09 01596_setting_limit_offset: [ OK ] 0.52 sec. 2026-03-09 10:33:09 01788_update_nested_type_subcolumn_check: [ OK ] 1.08 sec. 2026-03-09 10:33:09 02294_dictionaries_hierarchical_index: [ OK ] 0.67 sec. 2026-03-09 10:33:09 02479_nullable_primary_key_non_first_column: [ OK ] 0.52 sec. 2026-03-09 10:33:09 00652_replicated_mutations_zookeeper: [ OK ] 14.98 sec. 2026-03-09 10:33:09 03093_bug_gcd_codec: [ OK ] 0.63 sec. 2026-03-09 10:33:10 02960_alter_table_part_query_parameter: [ OK ] 0.47 sec. 2026-03-09 10:33:10 02518_parquet_arrow_orc_boolean_value: [ OK ] 1.44 sec. 2026-03-09 10:33:10 01096_zeros: [ OK ] 0.58 sec. 2026-03-09 10:33:10 01413_alter_update_supertype: [ OK ] 0.57 sec. 2026-03-09 10:33:10 02554_format_json_columns_for_empty: [ OK ] 0.42 sec. 2026-03-09 10:33:10 02493_numeric_literals_with_underscores: [ OK ] 1.43 sec. 2026-03-09 10:33:10 03157_dynamic_type_json: [ OK ] 0.52 sec. 2026-03-09 10:33:10 01483_merge_table_join_and_group_by: [ OK ] 0.72 sec. 2026-03-09 10:33:11 02286_tuple_numeric_identifier: [ OK ] 0.63 sec. 2026-03-09 10:33:11 01702_toDateTime_from_string_clamping: [ OK ] 0.48 sec. 2026-03-09 10:33:11 01683_intdiv_ubsan: [ OK ] 0.52 sec. 2026-03-09 10:33:11 02001_append_output_file: [ OK ] 1.43 sec. 2026-03-09 10:33:12 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.52 sec. 2026-03-09 10:33:12 02476_fix_lambda_parsing: [ OK ] 0.92 sec. 2026-03-09 10:33:12 01113_local_dictionary_type_conversion: [ OK ] 0.47 sec. 2026-03-09 10:33:12 02707_analyzer_nested_lambdas_types: [ OK ] 0.58 sec. 2026-03-09 10:33:12 02384_analyzer_dict_get_join_get: [ OK ] 0.68 sec. 2026-03-09 10:33:13 02003_compress_bz2: [ OK ] 1.62 sec. 2026-03-09 10:33:13 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 5.44 sec. 2026-03-09 10:33:13 02915_fpc_overflow: [ OK ] 1.18 sec. 2026-03-09 10:33:13 01471_with_format: [ OK ] 0.42 sec. 2026-03-09 10:33:13 00439_fixed_string_filter: [ OK ] 0.42 sec. 2026-03-09 10:33:13 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 0.78 sec. 2026-03-09 10:33:13 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 0.62 sec. 2026-03-09 10:33:14 02508_index_analysis_to_date_timezone: [ OK ] 0.52 sec. 2026-03-09 10:33:14 01273_arrow_nested_arrays_load: [ OK ] 3.53 sec. 2026-03-09 10:33:14 00348_tuples: [ OK ] 0.63 sec. 2026-03-09 10:33:14 00411_long_accurate_number_comparison_int2: [ OK ] 16.13 sec. 2026-03-09 10:33:14 00324_hashing_enums: [ OK ] 0.42 sec. 2026-03-09 10:33:14 00502_string_concat_with_array: [ OK ] 0.42 sec. 2026-03-09 10:33:14 00457_log_tinylog_stripelog_nullable: [ OK ] 0.72 sec. 2026-03-09 10:33:15 01791_dist_INSERT_block_structure_mismatch: [ OK ] 1.28 sec. 2026-03-09 10:33:15 00458_merge_type_cast: [ OK ] 1.13 sec. 2026-03-09 10:33:15 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 0.62 sec. 2026-03-09 10:33:15 02126_url_auth: [ OK ] 1.32 sec. 2026-03-09 10:33:15 00834_limit_with_constant_expressions: [ OK ] 0.67 sec. 2026-03-09 10:33:15 01247_least_greatest_filimonov: [ OK ] 0.43 sec. 2026-03-09 10:33:16 02416_rocksdb_delete_update: [ OK ] 0.82 sec. 2026-03-09 10:33:16 02918_gorilla_invalid_file: [ OK ] 0.78 sec. 2026-03-09 10:33:16 02235_check_table_sparse_serialization: [ OK ] 0.52 sec. 2026-03-09 10:33:16 00586_removing_unused_columns_from_subquery: [ OK ] 0.62 sec. 2026-03-09 10:33:16 03151_external_cross_join: [ OK ] 1.78 sec. 2026-03-09 10:33:16 00495_reading_const_zero_column: [ OK ] 0.52 sec. 2026-03-09 10:33:16 00160_merge_and_index_in_in: [ OK ] 3.94 sec. 2026-03-09 10:33:17 02884_duplicate_index_name: [ OK ] 0.52 sec. 2026-03-09 10:33:17 02473_extract_low_cardinality_from_json: [ OK ] 0.42 sec. 2026-03-09 10:33:17 02122_parallel_formatting_TSVWithNames: [ OK ] 2.88 sec. 2026-03-09 10:33:17 02723_jit_aggregation_bug_48120: [ OK ] 0.52 sec. 2026-03-09 10:33:17 02678_explain_pipeline_graph_with_projection: [ OK ] 0.47 sec. 2026-03-09 10:33:17 01825_type_json_nbagames: [ OK ] 8.65 sec. 2026-03-09 10:33:17 02990_optimize_uniq_to_count_alias: [ OK ] 0.57 sec. 2026-03-09 10:33:17 03150_url_hash_non_constant_level: [ OK ] 0.47 sec. 2026-03-09 10:33:18 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.42 sec. 2026-03-09 10:33:18 01015_empty_in_inner_right_join: [ OK ] 0.98 sec. 2026-03-09 10:33:18 01012_serialize_array_memory_usage: [ OK ] 0.62 sec. 2026-03-09 10:33:18 01521_max_length_alias: [ OK ] 0.57 sec. 2026-03-09 10:33:18 00680_duplicate_columns_inside_union_all: [ OK ] 0.52 sec. 2026-03-09 10:33:18 00956_http_prepared_statements: [ OK ] 0.93 sec. 2026-03-09 10:33:18 03069_analyzer_with_alias_in_array_join: [ OK ] 0.48 sec. 2026-03-09 10:33:18 00900_null_array_orc_load: [ OK ] 2.68 sec. 2026-03-09 10:33:18 00617_array_in: [ OK ] 0.53 sec. 2026-03-09 10:33:19 02014_map_different_keys: [ OK ] 0.57 sec. 2026-03-09 10:33:19 01056_predicate_optimizer_bugs: [ OK ] 0.97 sec. 2026-03-09 10:33:19 01799_long_uniq_theta_sketch: [ OK ] 2.63 sec. 2026-03-09 10:33:19 02956_rocksdb_with_ttl: [ OK ] 3.59 sec. 2026-03-09 10:33:19 02205_map_populate_series_non_const: [ OK ] 1.23 sec. 2026-03-09 10:33:19 02751_multiif_to_if_crash: [ OK ] 0.47 sec. 2026-03-09 10:33:19 03032_numbers_zeros: [ OK ] 0.62 sec. 2026-03-09 10:33:20 01318_map_populate_series: [ OK ] 0.67 sec. 2026-03-09 10:33:20 00262_alter_alias: [ OK ] 0.62 sec. 2026-03-09 10:33:20 01681_hyperscan_debug_assertion: [ SKIPPED ] 0.00 sec. 2026-03-09 10:33:20 Reason: not running for current build 2026-03-09 10:33:20 02764_parallel_replicas_plain_merge_tree: [ OK ] 0.52 sec. 2026-03-09 10:33:20 01821_join_table_mutation: [ OK ] 0.62 sec. 2026-03-09 10:33:21 00277_array_filter: [ OK ] 0.47 sec. 2026-03-09 10:33:21 02454_create_table_with_custom_disk: [ OK ] 0.57 sec. 2026-03-09 10:33:21 01710_normal_projection_join_plan_fix: [ OK ] 0.53 sec. 2026-03-09 10:33:21 02016_agg_empty_result_bug_28880: [ OK ] 0.47 sec. 2026-03-09 10:33:22 00860_unknown_identifier_bug: [ OK ] 0.53 sec. 2026-03-09 10:33:22 02784_disable_async_with_dedup_correctly: [ OK ] 3.63 sec. 2026-03-09 10:33:22 02010_lc_native: [ OK ] 2.33 sec. 2026-03-09 10:33:22 02899_distributed_limit_by: [ OK ] 1.18 sec. 2026-03-09 10:33:22 00034_fixed_string_to_number: [ OK ] 0.48 sec. 2026-03-09 10:33:23 01044_h3_edge_angle: [ OK ] 0.42 sec. 2026-03-09 10:33:23 01891_not_like_partition_prune: [ OK ] 0.47 sec. 2026-03-09 10:33:23 00906_low_cardinality_rollup: [ OK ] 0.52 sec. 2026-03-09 10:33:23 02263_format_insert_settings: [ OK ] 4.84 sec. 2026-03-09 10:33:23 02012_sha512_fixedstring: [ OK ] 0.52 sec. 2026-03-09 10:33:23 00534_functions_bad_arguments8: [ SKIPPED ] 0.00 sec. 2026-03-09 10:33:23 Reason: not running for current build 2026-03-09 10:33:23 02713_ip4_uint_compare: [ OK ] 0.47 sec. 2026-03-09 10:33:24 00373_group_by_tuple: [ OK ] 0.48 sec. 2026-03-09 10:33:24 01083_cross_to_inner_with_in_bug: [ OK ] 0.47 sec. 2026-03-09 10:33:24 01922_array_join_with_index: [ OK ] 0.47 sec. 2026-03-09 10:33:24 02987_group_array_intersect: [ OK ] 1.88 sec. 2026-03-09 10:33:24 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.57 sec. 2026-03-09 10:33:24 00234_disjunctive_equality_chains_optimization: [ OK ] 0.49 sec. 2026-03-09 10:33:25 01498_alter_column_storage_memory: [ OK ] 0.47 sec. 2026-03-09 10:33:25 01881_join_on_conditions_merge: [ OK ] 1.93 sec. 2026-03-09 10:33:25 00914_replicate: [ OK ] 0.47 sec. 2026-03-09 10:33:25 01097_one_more_range_reader_test_wide_part: [ OK ] 0.52 sec. 2026-03-09 10:33:25 02668_parse_datetime_in_joda_syntax: [ OK ] 1.48 sec. 2026-03-09 10:33:25 00357_to_string_complex_types: [ OK ] 0.47 sec. 2026-03-09 10:33:26 01549_low_cardinality_mv_fuzz: [ OK ] 0.42 sec. 2026-03-09 10:33:26 00878_join_unexpected_results: [ OK ] 0.83 sec. 2026-03-09 10:33:26 01825_type_json_from_map: [ OK ] 2.48 sec. 2026-03-09 10:33:26 02337_join_analyze_stuck: [ OK ] 0.78 sec. 2026-03-09 10:33:26 02661_quantile_approx: [ OK ] 1.02 sec. 2026-03-09 10:33:27 01770_extended_range_3: [ OK ] 0.48 sec. 2026-03-09 10:33:27 03207_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec. 2026-03-09 10:33:27 Reason: not running for current build 2026-03-09 10:33:27 02560_quantile_min_max: [ OK ] 0.42 sec. 2026-03-09 10:33:27 01600_min_max_compress_block_size: [ OK ] 0.47 sec. 2026-03-09 10:33:28 02790_client_max_opening_fd: [ OK ] 1.17 sec. 2026-03-09 10:33:28 01082_bit_test_out_of_bound: [ OK ] 0.63 sec. 2026-03-09 10:33:28 02588_avro_date32_and_decimals: [ OK ] 1.78 sec. 2026-03-09 10:33:28 01881_to_week_monotonic_fix: [ OK ] 0.47 sec. 2026-03-09 10:33:28 02915_input_table_function_in_subquery: [ OK ] 1.48 sec. 2026-03-09 10:33:29 02234_position_case_insensitive_utf8: [ OK ] 0.47 sec. 2026-03-09 10:33:29 03199_queries_with_new_analyzer: [ OK ] 0.52 sec. 2026-03-09 10:33:29 01019_materialized_view_select_extra_columns: [ OK ] 0.62 sec. 2026-03-09 10:33:29 02515_projections_with_totals: [ OK ] 0.47 sec. 2026-03-09 10:33:29 00969_columns_clause: [ OK ] 0.63 sec. 2026-03-09 10:33:30 02024_compression_in_query: [ OK ] 5.04 sec. 2026-03-09 10:33:30 01866_datetime64_cmp_with_constant: [ OK ] 0.68 sec. 2026-03-09 10:33:30 01036_union_different_columns: [ OK ] 0.43 sec. 2026-03-09 10:33:30 01921_datatype_date32: [ OK ] 1.23 sec. 2026-03-09 10:33:31 03033_create_as_copies_comment: [ OK ] 0.47 sec. 2026-03-09 10:33:31 01559_misplaced_codec_diagnostics: [ OK ] 0.52 sec. 2026-03-09 10:33:31 02015_async_inserts_1: [ OK ] 2.48 sec. 2026-03-09 10:33:32 03093_special_column_errors: [ OK ] 0.87 sec. 2026-03-09 10:33:33 02354_window_expression_with_aggregation_expression: [ OK ] 0.42 sec. 2026-03-09 10:33:33 02810_async_insert_dedup_replicated_collapsing: [ OK ] 13.47 sec. 2026-03-09 10:33:33 02661_read_from_archive_targz: [ OK ] 14.77 sec. 2026-03-09 10:33:34 01825_type_json_16: [ OK ] 3.43 sec. 2026-03-09 10:33:35 01761_cast_to_enum_nullable: [ OK ] 0.43 sec. 2026-03-09 10:33:35 02461_alter_update_respect_part_column_type_bug: [ OK ] 2.58 sec. 2026-03-09 10:33:35 02575_merge_prewhere_materialized: [ OK ] 0.57 sec. 2026-03-09 10:33:36 03019_numbers_pretty: [ OK ] 0.47 sec. 2026-03-09 10:33:36 01388_clear_all_columns: [ OK ] 0.63 sec. 2026-03-09 10:33:36 02688_long_aggregate_function_names: [ OK ] 0.43 sec. 2026-03-09 10:33:36 00578_merge_table_sampling: [ OK ] 0.58 sec. 2026-03-09 10:33:37 02499_analyzer_set_index: [ OK ] 0.52 sec. 2026-03-09 10:33:37 01385_not_function: [ OK ] 0.42 sec. 2026-03-09 10:33:37 02287_ephemeral_format_crash: [ OK ] 0.42 sec. 2026-03-09 10:33:37 01825_type_json_4: [ OK ] 4.23 sec. 2026-03-09 10:33:38 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 0.54 sec. 2026-03-09 10:33:38 01673_test_toMinute_mysql_dialect: [ OK ] 0.42 sec. 2026-03-09 10:33:38 02374_in_tuple_index: [ OK ] 0.53 sec. 2026-03-09 10:33:38 03068_analyzer_distributed_join: [ OK ] 0.62 sec. 2026-03-09 10:33:38 02271_temporary_table_show_rows_bytes: [ OK ] 0.42 sec. 2026-03-09 10:33:39 03066_analyzer_global_with_statement: [ OK ] 0.43 sec. 2026-03-09 10:33:39 02118_deserialize_whole_text: [ OK ] 8.61 sec. 2026-03-09 10:33:39 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 0.89 sec. 2026-03-09 10:33:39 00154_shard_distributed_with_distinct: [ OK ] 0.47 sec. 2026-03-09 10:33:39 01825_new_type_json_multiple_files: [ OK ] 6.14 sec. 2026-03-09 10:33:39 01882_scalar_subquery_exception: [ OK ] 0.52 sec. 2026-03-09 10:33:39 01475_fix_bigint_shift: [ OK ] 0.42 sec. 2026-03-09 10:33:39 03015_aggregator_empty_data_multiple_blocks: [ OK ] 0.47 sec. 2026-03-09 10:33:40 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.47 sec. 2026-03-09 10:33:40 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.42 sec. 2026-03-09 10:33:40 02203_shebang: [ OK ] 0.88 sec. 2026-03-09 10:33:40 02943_variant_element: [ OK ] 0.52 sec. 2026-03-09 10:33:40 02354_vector_search_detach_attach: [ OK ] 0.53 sec. 2026-03-09 10:33:40 02950_part_log_bytes_uncompressed: [ OK ] 0.58 sec. 2026-03-09 10:33:40 01674_clickhouse_client_query_param_cte: [ OK ] 1.13 sec. 2026-03-09 10:33:41 03203_optimize_disjunctions_chain_to_in: [ OK ] 0.47 sec. 2026-03-09 10:33:41 00612_http_max_query_size_for_distributed: [ OK ] 0.52 sec. 2026-03-09 10:33:41 02968_url_args: [ OK ] 0.42 sec. 2026-03-09 10:33:41 01076_range_reader_segfault: [ OK ] 0.53 sec. 2026-03-09 10:33:42 00097_long_storage_buffer_race_condition: [ OK ] 21.81 sec. 2026-03-09 10:33:42 01950_kill_large_group_by_query: [ OK ] 2.08 sec. 2026-03-09 10:33:42 02992_analyzer_group_by_const: [ OK ] 0.72 sec. 2026-03-09 10:33:42 01646_rewrite_sum_if: [ OK ] 0.73 sec. 2026-03-09 10:33:42 02809_has_subsequence: [ OK ] 0.72 sec. 2026-03-09 10:33:43 03095_join_filter_push_down_right_stream_filled: [ OK ] 0.57 sec. 2026-03-09 10:33:43 00952_input_function: [ OK ] 12.11 sec. 2026-03-09 10:33:43 00980_crash_nullable_decimal: [ OK ] 0.48 sec. 2026-03-09 10:33:43 00604_show_create_database: [ OK ] 0.37 sec. 2026-03-09 10:33:43 03165_order_by_duplicate: [ OK ] 0.47 sec. 2026-03-09 10:33:43 01019_array_fill: [ OK ] 0.52 sec. 2026-03-09 10:33:44 02373_datetime64_monotonicity: [ OK ] 3.94 sec. 2026-03-09 10:33:44 02366_kql_distinct: [ OK ] 0.52 sec. 2026-03-09 10:33:44 00287_column_const_with_nan: [ OK ] 0.47 sec. 2026-03-09 10:33:44 01279_empty_external_table: [ OK ] 1.93 sec. 2026-03-09 10:33:45 00313_const_totals_extremes: [ OK ] 0.87 sec. 2026-03-09 10:33:45 02875_fix_column_decimal_serialization: [ OK ] 0.57 sec. 2026-03-09 10:33:45 00030_alter_table: [ OK ] 0.83 sec. 2026-03-09 10:33:45 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ SKIPPED ] 0.00 sec. 2026-03-09 10:33:45 Reason: not running for current build 2026-03-09 10:33:45 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 0.77 sec. 2026-03-09 10:33:45 01358_constexpr_constraint: [ OK ] 0.63 sec. 2026-03-09 10:33:45 01940_custom_tld_sharding_key: [ OK ] 0.67 sec. 2026-03-09 10:33:45 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.63 sec. 2026-03-09 10:33:46 02891_rename_table_without_keyword: [ OK ] 0.68 sec. 2026-03-09 10:33:46 01825_type_json_in_other_types: [ OK ] 5.59 sec. 2026-03-09 10:33:46 02122_parallel_formatting_JSON: [ OK ] 3.79 sec. 2026-03-09 10:33:46 01076_predicate_optimizer_with_view: [ OK ] 0.68 sec. 2026-03-09 10:33:46 00687_insert_into_mv: [ OK ] 0.74 sec. 2026-03-09 10:33:46 00196_float32_formatting: [ OK ] 0.73 sec. 2026-03-09 10:33:46 02811_parallel_replicas_prewhere_count: [ OK ] 0.69 sec. 2026-03-09 10:33:47 03003_enum_and_string_compatible: [ OK ] 0.53 sec. 2026-03-09 10:33:47 01532_collate_in_low_cardinality: [ OK ] 0.83 sec. 2026-03-09 10:33:47 01925_merge_prewhere_table: [ OK ] 0.63 sec. 2026-03-09 10:33:47 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 0.98 sec. 2026-03-09 10:33:47 02810_row_binary_with_defaults: [ OK ] 0.68 sec. 2026-03-09 10:33:47 01085_datetime_arithmetic_preserve_timezone: [ OK ] 0.49 sec. 2026-03-09 10:33:47 02455_extract_fixed_string_from_nested_json: [ OK ] 0.58 sec. 2026-03-09 10:33:47 01567_system_processes_current_database: [ OK ] 0.53 sec. 2026-03-09 10:33:48 01656_ipv4_bad_formatting: [ OK ] 0.48 sec. 2026-03-09 10:33:48 02507_to_unix_timestamp_overflow: [ OK ] 0.63 sec. 2026-03-09 10:33:48 00632_get_sample_block_cache: [ OK ] 19.45 sec. 2026-03-09 10:33:48 02911_add_index_and_materialize_index: [ OK ] 0.42 sec. 2026-03-09 10:33:48 02497_source_part_is_intact_when_mutation: [ OK ] 0.73 sec. 2026-03-09 10:33:48 01604_explain_ast_of_nonselect_query: [ OK ] 0.48 sec. 2026-03-09 10:33:48 02478_window_frame_type_groups: [ OK ] 0.53 sec. 2026-03-09 10:33:48 02267_output_format_prometheus: [ OK ] 0.57 sec. 2026-03-09 10:33:48 02705_grouping_keys_equal_keys: [ OK ] 0.43 sec. 2026-03-09 10:33:49 01771_datetime64_no_time_part: [ OK ] 0.48 sec. 2026-03-09 10:33:49 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.58 sec. 2026-03-09 10:33:49 02517_avro_bool_type: [ OK ] 1.07 sec. 2026-03-09 10:33:49 02029_test_implemented_methods: [ OK ] 0.83 sec. 2026-03-09 10:33:49 02921_file_engine_size_virtual_column: [ OK ] 1.63 sec. 2026-03-09 10:33:49 02100_now64_types_bug: [ OK ] 0.47 sec. 2026-03-09 10:33:49 02751_multiquery_with_argument: [ OK ] 3.50 sec. 2026-03-09 10:33:49 00534_functions_bad_arguments4_long: [ SKIPPED ] 0.00 sec. 2026-03-09 10:33:49 Reason: not running for current build 2026-03-09 10:33:49 02046_low_cardinality_parallel_group_by: [ OK ] 6.30 sec. 2026-03-09 10:33:49 00552_or_nullable: [ OK ] 0.52 sec. 2026-03-09 10:33:50 02788_current_schemas_function: [ OK ] 0.57 sec. 2026-03-09 10:33:50 00844_join_lightee2: [ OK ] 0.47 sec. 2026-03-09 10:33:50 02950_reading_array_tuple_subcolumns: [ OK ] 0.87 sec. 2026-03-09 10:33:50 00752_low_cardinality_permute: [ OK ] 0.47 sec. 2026-03-09 10:33:50 00522_multidimensional: [ OK ] 0.98 sec. 2026-03-09 10:33:51 01056_prepared_statements_null_and_escaping: [ OK ] 0.97 sec. 2026-03-09 10:33:51 00080_show_tables_and_system_tables: [ OK ] 0.57 sec. 2026-03-09 10:33:51 02802_clickhouse_disks_s3_copy: [ OK ] 1.83 sec. 2026-03-09 10:33:51 02842_mutations_replace_non_deterministic: [ OK ] 1.48 sec. 2026-03-09 10:33:51 01691_DateTime64_clamp: [ OK ] 0.57 sec. 2026-03-09 10:33:52 01785_pmj_lc_bug: [ OK ] 0.52 sec. 2026-03-09 10:33:52 03034_ddls_and_merges_with_unusual_maps: [ OK ] 0.67 sec. 2026-03-09 10:33:54 01095_tpch_like_smoke: [ OK ] 1.63 sec. 2026-03-09 10:33:54 01473_system_events_zeroes: [ OK ] 0.42 sec. 2026-03-09 10:33:55 00273_quantiles: [ OK ] 0.73 sec. 2026-03-09 10:33:55 02714_async_inserts_empty_data: [ OK ] 3.63 sec. 2026-03-09 10:33:55 02555_davengers_rename_chain: [ OK ] 5.59 sec. 2026-03-09 10:33:55 00607_index_in_in: [ OK ] 0.57 sec. 2026-03-09 10:33:56 02705_projection_and_ast_optimizations_bug: [ OK ] 0.53 sec. 2026-03-09 10:33:56 02346_to_hour_monotonicity_fix: [ OK ] 0.57 sec. 2026-03-09 10:33:57 00700_decimal_aggregates: [ OK ] 1.33 sec. 2026-03-09 10:33:57 02017_bit_shift_left_for_string_integer: [ OK ] 1.43 sec. 2026-03-09 10:33:57 03246_alter_update_dynamic_hung: [ OK ] 0.62 sec. 2026-03-09 10:33:58 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 0.73 sec. 2026-03-09 10:33:58 02563_progress_when_no_rows_from_prewhere: [ SKIPPED ] 0.00 sec. 2026-03-09 10:33:58 Reason: not running for current build 2026-03-09 10:33:58 03203_client_benchmark_options: [ OK ] 7.55 sec. 2026-03-09 10:33:58 02402_merge_engine_with_view: [ OK ] 0.52 sec. 2026-03-09 10:33:58 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 0.98 sec. 2026-03-09 10:33:59 03321_functions_to_subcolumns_skip_index: [ OK ] 0.52 sec. 2026-03-09 10:33:59 02533_generate_random_schema_inference: [ OK ] 0.47 sec. 2026-03-09 10:33:59 01280_unicode_whitespaces_lexer: [ OK ] 0.43 sec. 2026-03-09 10:34:00 00940_max_parts_in_total: [ OK ] 0.57 sec. 2026-03-09 10:34:00 00848_join_use_nulls_segfault: [ OK ] 0.97 sec. 2026-03-09 10:34:00 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 1.98 sec. 2026-03-09 10:34:01 02183_combinator_if: [ OK ] 0.97 sec. 2026-03-09 10:34:01 00996_neighbor: [ OK ] 0.58 sec. 2026-03-09 10:34:01 02201_use_skip_indexes_if_final: [ OK ] 0.52 sec. 2026-03-09 10:34:02 02343_analyzer_column_transformers_strict: [ OK ] 0.52 sec. 2026-03-09 10:34:02 00712_prewhere_with_final: [ OK ] 0.52 sec. 2026-03-09 10:34:03 03215_parsing_archive_name_s3: [ OK ] 0.73 sec. 2026-03-09 10:34:03 00445_join_nullable_keys: [ OK ] 0.53 sec. 2026-03-09 10:34:04 01463_resample_overflow: [ OK ] 0.43 sec. 2026-03-09 10:34:04 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.52 sec. 2026-03-09 10:34:04 02354_read_in_order_prewhere: [ OK ] 2.83 sec. 2026-03-09 10:34:08 03038_nested_dynamic_merges_wide_horizontal: [ OK ] 7.90 sec. 2026-03-09 10:34:08 01926_order_by_desc_limit: [ OK ] 3.88 sec. 2026-03-09 10:34:08 00411_long_accurate_number_comparison_int1: [ OK ] 20.80 sec. 2026-03-09 10:34:09 03001_block_offset_column: [ OK ] 0.83 sec. 2026-03-09 10:34:09 02423_ddl_for_opentelemetry: [ OK ] 13.23 sec. 2026-03-09 10:34:09 01926_date_date_time_supertype: [ OK ] 0.52 sec. 2026-03-09 10:34:09 03039_dynamic_summing_merge_tree: [ OK ] 19.40 sec. 2026-03-09 10:34:09 02042_map_get_non_const_key: [ OK ] 0.43 sec. 2026-03-09 10:34:09 02899_indexing_by_space_filling_curves: [ OK ] 0.87 sec. 2026-03-09 10:34:09 02471_wrong_date_monotonicity: [ OK ] 0.52 sec. 2026-03-09 10:34:10 02833_url_without_path_encoding: [ OK ] 1.68 sec. 2026-03-09 10:34:10 00637_sessions_in_http_interface_and_settings: [ OK ] 0.77 sec. 2026-03-09 10:34:11 01746_forbid_drop_column_referenced_by_mv: [ OK ] 0.92 sec. 2026-03-09 10:34:11 03207_json_read_subcolumns_1_memory: [ OK ] 1.68 sec. 2026-03-09 10:34:11 02125_transform_decimal_bug: [ OK ] 0.47 sec. 2026-03-09 10:34:11 02158_proportions_ztest: [ OK ] 0.52 sec. 2026-03-09 10:34:12 00520_tuple_values_interpreter: [ OK ] 0.47 sec. 2026-03-09 10:34:12 01663_aes_msan: [ OK ] 0.48 sec. 2026-03-09 10:34:13 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 1.32 sec. 2026-03-09 10:34:13 01825_type_json_15: [ OK ] 3.53 sec. 2026-03-09 10:34:13 00028_shard_big_agg_aj_distributed: [ OK ] 0.63 sec. 2026-03-09 10:34:14 02922_respect_nulls_extensive: [ OK ] 1.17 sec. 2026-03-09 10:34:14 01031_mutations_interpreter_and_context: [ OK ] 3.58 sec. 2026-03-09 10:34:15 00821_distributed_storage_with_join_on: [ OK ] 0.67 sec. 2026-03-09 10:34:15 02916_replication_protocol_wait_for_part: [ OK ] 10.81 sec. 2026-03-09 10:34:15 02498_storage_join_key_positions: [ OK ] 1.38 sec. 2026-03-09 10:34:16 01746_long_zlib_http_compression_json_format: [ OK ] 1.03 sec. 2026-03-09 10:34:17 00937_format_schema_rows_template: [ OK ] 3.89 sec. 2026-03-09 10:34:17 00951_ngram_search: [ OK ] 1.63 sec. 2026-03-09 10:34:17 03013_repeat_with_nonnative_integers: [ OK ] 0.47 sec. 2026-03-09 10:34:17 01525_select_with_offset_fetch_clause: [ OK ] 0.47 sec. 2026-03-09 10:34:17 01273_arrow: [ OK ] 25.58 sec. 2026-03-09 10:34:18 01798_uniq_theta_sketch: [ OK ] 1.28 sec. 2026-03-09 10:34:18 02833_std_alias: [ OK ] 0.47 sec. 2026-03-09 10:34:18 02112_skip_index_set_and_or: [ OK ] 0.43 sec. 2026-03-09 10:34:18 02383_join_and_filtering_set: [ OK ] 5.49 sec. 2026-03-09 10:34:19 02131_used_row_policies_in_query_log: [ OK ] 1.07 sec. 2026-03-09 10:34:19 01319_query_formatting_in_server_log: [ OK ] 0.83 sec. 2026-03-09 10:34:19 02429_low_cardinality_trash: [ OK ] 0.88 sec. 2026-03-09 10:34:19 01038_array_of_unnamed_tuples: [ OK ] 0.47 sec. 2026-03-09 10:34:19 00038_totals_limit: [ OK ] 0.42 sec. 2026-03-09 10:34:19 02813_seriesDecomposeSTL: [ OK ] 0.68 sec. 2026-03-09 10:34:20 00754_alter_modify_column_partitions: [ OK ] 0.87 sec. 2026-03-09 10:34:20 02981_vertical_merges_memory_usage: [ OK ] 2.28 sec. 2026-03-09 10:34:20 02162_array_first_last_index: [ OK ] 0.62 sec. 2026-03-09 10:34:20 01308_row_policy_and_trivial_count_query: [ OK ] 0.52 sec. 2026-03-09 10:34:21 02418_keeper_map_keys_limit: [ OK ] 0.67 sec. 2026-03-09 10:34:21 02019_multiple_weird_with_fill: [ OK ] 0.43 sec. 2026-03-09 10:34:22 03169_modify_column_data_loss: [ OK ] 0.57 sec. 2026-03-09 10:34:22 00674_has_array_enum: [ OK ] 0.47 sec. 2026-03-09 10:34:23 01509_parallel_quorum_and_merge_long: [ OK ] 8.41 sec. 2026-03-09 10:34:23 01615_two_args_function_index_fix: [ OK ] 0.48 sec. 2026-03-09 10:34:24 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 3.84 sec. 2026-03-09 10:34:24 01822_short_circuit: [ OK ] 1.43 sec. 2026-03-09 10:34:24 00321_pk_set: [ OK ] 0.52 sec. 2026-03-09 10:34:24 01165_lost_part_empty_partition: [ OK ] 3.83 sec. 2026-03-09 10:34:24 02482_insert_into_dist_race: [ OK ] 0.62 sec. 2026-03-09 10:34:25 01926_union_all_schmak: [ OK ] 0.47 sec. 2026-03-09 10:34:25 01853_s2_cells_intersect: [ OK ] 0.52 sec. 2026-03-09 10:34:25 00396_uuid: [ OK ] 0.52 sec. 2026-03-09 10:34:25 00029_test_zookeeper_optimize_exception: [ OK ] 6.34 sec. 2026-03-09 10:34:25 00818_alias_bug_4110: [ OK ] 0.62 sec. 2026-03-09 10:34:25 00832_storage_file_lock: [ OK ] 0.47 sec. 2026-03-09 10:34:26 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 0.78 sec. 2026-03-09 10:34:26 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 2.73 sec. 2026-03-09 10:34:27 00652_mutations_alter_update: [ OK ] 17.28 sec. 2026-03-09 10:34:27 01010_pmj_skip_blocks: [ OK ] 1.57 sec. 2026-03-09 10:34:27 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 7.62 sec. 2026-03-09 10:34:27 01431_utf8_ubsan: [ OK ] 0.42 sec. 2026-03-09 10:34:27 02344_describe_cache: [ OK ] 1.98 sec. 2026-03-09 10:34:28 00379_system_processes_port: [ OK ] 0.72 sec. 2026-03-09 10:34:28 01784_parallel_formatting_memory: [ OK ] 0.57 sec. 2026-03-09 10:34:28 02479_mysql_connect_to_self: [ OK ] 1.02 sec. 2026-03-09 10:34:28 00085_visible_width_of_tuple_of_dates: [ OK ] 0.42 sec. 2026-03-09 10:34:28 01244_optimize_distributed_group_by_sharding_key: [ OK ] 1.73 sec. 2026-03-09 10:34:28 02916_set_formatting: [ OK ] 0.42 sec. 2026-03-09 10:34:29 01093_cyclic_defaults_filimonov: [ OK ] 0.62 sec. 2026-03-09 10:34:29 00939_limit_by_offset: [ OK ] 0.52 sec. 2026-03-09 10:34:29 00500_point_in_polygon: [ OK ] 0.88 sec. 2026-03-09 10:34:29 02539_generate_random_ip: [ OK ] 0.42 sec. 2026-03-09 10:34:29 01268_procfs_metrics: [ OK ] 1.28 sec. 2026-03-09 10:34:29 01034_unknown_qualified_column_in_join: [ OK ] 0.57 sec. 2026-03-09 10:34:29 00927_disable_hyperscan: [ OK ] 0.67 sec. 2026-03-09 10:34:29 01272_suspicious_codecs: [ OK ] 1.03 sec. 2026-03-09 10:34:30 00365_statistics_in_formats: [ OK ] 3.58 sec. 2026-03-09 10:34:30 02124_encrypt_decrypt_nullable: [ OK ] 0.53 sec. 2026-03-09 10:34:30 02835_join_step_explain: [ OK ] 0.57 sec. 2026-03-09 10:34:30 00930_arrayIntersect: [ OK ] 0.67 sec. 2026-03-09 10:34:30 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 0.52 sec. 2026-03-09 10:34:30 03038_nested_dynamic_merges_compact_horizontal: [ OK ] 5.34 sec. 2026-03-09 10:34:30 02896_cyclic_aliases_crash: [ OK ] 0.52 sec. 2026-03-09 10:34:30 03014_msan_parse_date_time: [ OK ] 0.52 sec. 2026-03-09 10:34:30 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.42 sec. 2026-03-09 10:34:30 02002_sampling_and_unknown_column_bug: [ OK ] 0.53 sec. 2026-03-09 10:34:31 02050_clickhouse_local_parsing_exception: [ OK ] 0.82 sec. 2026-03-09 10:34:31 01849_geoToS2: [ OK ] 0.77 sec. 2026-03-09 10:34:31 02835_fuzz_remove_redundant_sorting: [ OK ] 0.52 sec. 2026-03-09 10:34:31 00538_datediff: [ OK ] 0.82 sec. 2026-03-09 10:34:31 00609_distributed_with_case_when_then: [ OK ] 0.57 sec. 2026-03-09 10:34:31 00143_number_classification_functions: [ OK ] 0.62 sec. 2026-03-09 10:34:31 02416_keeper_map: [ OK ] 1.32 sec. 2026-03-09 10:34:31 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.62 sec. 2026-03-09 10:34:32 03215_varian_as_common_type_integers: [ OK ] 0.47 sec. 2026-03-09 10:34:32 03196_max_intersections_arena_crash: [ OK ] 0.47 sec. 2026-03-09 10:34:32 02346_fulltext_index_bug52019: [ OK ] 0.57 sec. 2026-03-09 10:34:32 02420_stracktrace_debug_symbols: [ OK ] 1.07 sec. 2026-03-09 10:34:32 01748_partition_id_pruning: [ OK ] 0.62 sec. 2026-03-09 10:34:33 02875_final_invalid_read_ranges_bug: [ OK ] 0.63 sec. 2026-03-09 10:34:33 01412_row_from_totals: [ OK ] 0.67 sec. 2026-03-09 10:34:34 01785_parallel_formatting_memory: [ OK ] 1.83 sec. 2026-03-09 10:34:34 02570_fallback_from_async_insert: [ OK ] 4.48 sec. 2026-03-09 10:34:34 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.47 sec. 2026-03-09 10:34:35 00100_subquery_table_identifier: [ OK ] 2.78 sec. 2026-03-09 10:34:35 03115_alias_exists_column: [ OK ] 0.42 sec. 2026-03-09 10:34:35 01282_system_parts_ttl_info: [ OK ] 0.47 sec. 2026-03-09 10:34:35 00938_fix_rwlock_segfault_long: [ SKIPPED ] 0.00 sec. 2026-03-09 10:34:35 Reason: not running for current build 2026-03-09 10:34:35 02163_operators: [ OK ] 0.43 sec. 2026-03-09 10:34:36 03159_dynamic_type_all_types: [ OK ] 0.68 sec. 2026-03-09 10:34:36 01099_operators_date_and_timestamp: [ OK ] 1.18 sec. 2026-03-09 10:34:37 01710_projection_detach_part: [ OK ] 0.52 sec. 2026-03-09 10:34:37 00688_low_cardinality_dictionary_deserialization: [ OK ] 1.28 sec. 2026-03-09 10:34:37 02963_remote_read_small_buffer_size_bug: [ OK ] 6.86 sec. 2026-03-09 10:34:37 02691_multiple_joins_backtick_identifiers: [ OK ] 0.62 sec. 2026-03-09 10:34:38 01691_parser_data_type_exponential: [ OK ] 4.44 sec. 2026-03-09 10:34:38 02752_space_function: [ OK ] 0.72 sec. 2026-03-09 10:34:38 01667_aes_args_check: [ OK ] 0.37 sec. 2026-03-09 10:34:38 03153_dynamic_type_empty: [ OK ] 0.52 sec. 2026-03-09 10:34:38 02345_create_table_allow_trailing_comma: [ OK ] 0.47 sec. 2026-03-09 10:34:38 00811_garbage: [ OK ] 0.47 sec. 2026-03-09 10:34:38 03008_index_small: [ OK ] 0.52 sec. 2026-03-09 10:34:39 01780_column_sparse_filter: [ OK ] 0.57 sec. 2026-03-09 10:34:39 00700_decimal_null: [ OK ] 0.72 sec. 2026-03-09 10:34:39 03201_avro_negative_block_size_arrays: [ OK ] 1.18 sec. 2026-03-09 10:34:39 00800_low_cardinality_merge_join: [ OK ] 1.78 sec. 2026-03-09 10:34:39 01450_set_null_const: [ OK ] 0.52 sec. 2026-03-09 10:34:40 01079_bad_alters_zookeeper_long: [ OK ] 8.81 sec. 2026-03-09 10:34:40 02967_analyzer_fuzz: [ OK ] 0.52 sec. 2026-03-09 10:34:40 01783_parallel_formatting_memory: [ OK ] 0.87 sec. 2026-03-09 10:34:40 01213_alter_rename_nested: [ OK ] 0.52 sec. 2026-03-09 10:34:40 02713_array_low_cardinality_string: [ OK ] 0.47 sec. 2026-03-09 10:34:41 02735_array_map_array_of_tuples: [ OK ] 0.47 sec. 2026-03-09 10:34:41 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.47 sec. 2026-03-09 10:34:41 00580_cast_nullable_to_non_nullable: [ OK ] 0.47 sec. 2026-03-09 10:34:41 03169_cache_complex_dict_short_circuit_bug: [ OK ] 0.52 sec. 2026-03-09 10:34:44 02047_log_family_data_file_sizes: [ OK ] 9.00 sec. 2026-03-09 10:34:45 03038_recursive_cte_postgres_4: [ OK ] 0.67 sec. 2026-03-09 10:34:46 02025_storage_filelog_virtual_col: [ OK ] 6.04 sec. 2026-03-09 10:34:46 01001_rename_merge_race_condition: [ OK ] 12.57 sec. 2026-03-09 10:34:46 02594_msgpack_more_types: [ OK ] 1.18 sec. 2026-03-09 10:34:46 03037_dynamic_merges_2_horizontal_compact_merge_tree: [ OK ] 0.77 sec. 2026-03-09 10:34:47 02809_prewhere_and_in: [ OK ] 0.67 sec. 2026-03-09 10:34:47 00356_analyze_aggregations_and_union_all: [ OK ] 0.48 sec. 2026-03-09 10:34:47 01187_set_profile_as_setting: [ OK ] 1.37 sec. 2026-03-09 10:34:47 00700_decimal_with_default_precision_and_scale: [ OK ] 0.53 sec. 2026-03-09 10:34:47 02843_backup_use_same_password_for_base_backup: [ OK ] 6.29 sec. 2026-03-09 10:34:47 01655_sleep_infinite_float: [ OK ] 0.47 sec. 2026-03-09 10:34:48 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 0.72 sec. 2026-03-09 10:34:48 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 0.67 sec. 2026-03-09 10:34:48 02874_json_merge_patch_function_test: [ OK ] 0.57 sec. 2026-03-09 10:34:48 01581_deduplicate_by_columns_local: [ OK ] 1.07 sec. 2026-03-09 10:34:49 00763_create_query_as_table_engine_bug: [ OK ] 0.47 sec. 2026-03-09 10:34:49 01085_extract_all_empty: [ OK ] 0.42 sec. 2026-03-09 10:34:49 02242_if_then_else_null_bug: [ OK ] 0.48 sec. 2026-03-09 10:34:49 03111_inner_join_group_by: [ OK ] 0.43 sec. 2026-03-09 10:34:50 01753_optimize_aggregation_in_order: [ OK ] 1.18 sec. 2026-03-09 10:34:50 00499_json_enum_insert: [ OK ] 0.52 sec. 2026-03-09 10:34:50 00800_function_java_hash: [ OK ] 0.57 sec. 2026-03-09 10:34:50 02516_projections_with_rollup: [ OK ] 2.78 sec. 2026-03-09 10:34:50 02510_group_by_prewhere_null: [ OK ] 0.47 sec. 2026-03-09 10:34:50 00155_long_merges: [ SKIPPED ] 0.00 sec. 2026-03-09 10:34:50 Reason: not running for current build 2026-03-09 10:34:51 02474_extract_fixedstring_from_json: [ OK ] 0.52 sec. 2026-03-09 10:34:51 00752_low_cardinality_lambda_argument: [ OK ] 0.52 sec. 2026-03-09 10:34:51 00986_materialized_view_stack_overflow: [ OK ] 1.03 sec. 2026-03-09 10:34:51 01632_max_partitions_to_read: [ OK ] 0.57 sec. 2026-03-09 10:34:51 02291_dictionary_scalar_subquery_reload: [ OK ] 0.62 sec. 2026-03-09 10:34:52 01763_long_ttl_group_by: [ OK ] 2.08 sec. 2026-03-09 10:34:52 01293_pretty_max_value_width: [ OK ] 0.57 sec. 2026-03-09 10:34:52 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.57 sec. 2026-03-09 10:34:52 02895_npy_format: [ OK ] 11.11 sec. 2026-03-09 10:34:52 00600_create_temporary_table_if_not_exists: [ OK ] 0.42 sec. 2026-03-09 10:34:52 02870_per_column_settings: [ OK ] 0.67 sec. 2026-03-09 10:34:53 03166_optimize_row_order_during_insert: [ OK ] 0.78 sec. 2026-03-09 10:34:53 00339_parsing_bad_arrays: [ OK ] 0.88 sec. 2026-03-09 10:34:54 01943_query_id_check: [ OK ] 1.73 sec. 2026-03-09 10:34:54 02910_object-json-crash-add-column: [ OK ] 0.63 sec. 2026-03-09 10:34:54 03173_distinct_combinator_alignment: [ OK ] 0.43 sec. 2026-03-09 10:34:54 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec. 2026-03-09 10:34:54 Reason: not running for current build 2026-03-09 10:34:55 02266_auto_add_nullable: [ OK ] 0.52 sec. 2026-03-09 10:34:56 03214_backup_and_clear_old_temporary_directories: [ OK ] 4.74 sec. 2026-03-09 10:34:56 03036_reading_s3_archives: [ OK ] 1.28 sec. 2026-03-09 10:34:56 00619_extract: [ OK ] 0.52 sec. 2026-03-09 10:34:56 02661_read_from_archive_zip: [ OK ] 14.87 sec. 2026-03-09 10:34:57 02798_generic_transform: [ OK ] 0.52 sec. 2026-03-09 10:34:57 02859_replicated_db_name_zookeeper: [ OK ] 3.33 sec. 2026-03-09 10:34:57 00098_j_union_all: [ OK ] 0.42 sec. 2026-03-09 10:34:57 02370_lost_part_intersecting_merges: [ OK ] 18.48 sec. 2026-03-09 10:34:57 02245_s3_virtual_columns: [ OK ] 0.57 sec. 2026-03-09 10:34:57 00409_shard_limit_by: [ OK ] 0.67 sec. 2026-03-09 10:34:58 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 3.94 sec. 2026-03-09 10:34:58 00753_alter_attach: [ OK ] 1.73 sec. 2026-03-09 10:34:58 01798_having_push_down: [ OK ] 0.57 sec. 2026-03-09 10:34:58 00700_to_decimal_or_something: [ OK ] 0.92 sec. 2026-03-09 10:34:58 03155_explain_current_transaction: [ OK ] 0.47 sec. 2026-03-09 10:34:58 01460_mark_inclusion_search_crash: [ OK ] 0.52 sec. 2026-03-09 10:34:58 03008_filter_projections_non_deterministoc_functions: [ OK ] 0.92 sec. 2026-03-09 10:34:58 01356_initialize_aggregation: [ OK ] 0.47 sec. 2026-03-09 10:34:58 03443_projection_sparse: [ OK ] 0.52 sec. 2026-03-09 10:34:59 01592_toUnixTimestamp_Date: [ OK ] 0.42 sec. 2026-03-09 10:34:59 01051_same_name_alias_with_joins: [ OK ] 0.52 sec. 2026-03-09 10:34:59 00831_quantile_weighted_parameter_check: [ OK ] 0.52 sec. 2026-03-09 10:34:59 02813_func_now_and_alias: [ OK ] 0.47 sec. 2026-03-09 10:34:59 02921_fuzzbits_with_array_join: [ OK ] 0.42 sec. 2026-03-09 10:34:59 00679_uuid_in_key: [ OK ] 0.52 sec. 2026-03-09 10:35:00 01375_null_issue_3767: [ OK ] 0.48 sec. 2026-03-09 10:35:00 02815_join_algorithm_setting: [ OK ] 1.33 sec. 2026-03-09 10:35:00 03003_analyzer_setting: [ OK ] 0.48 sec. 2026-03-09 10:35:00 00380_client_break_at_exception_in_batch_mode: [ OK ] 1.23 sec. 2026-03-09 10:35:01 01323_redundant_functions_in_order_by: [ OK ] 0.98 sec. 2026-03-09 10:35:01 03208_array_of_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec. 2026-03-09 10:35:01 Reason: not running for current build 2026-03-09 10:35:01 01818_move_partition_simple: [ OK ] 0.73 sec. 2026-03-09 10:35:01 02125_dict_get_type_nullable_fix: [ OK ] 0.53 sec. 2026-03-09 10:35:01 02493_inconsistent_hex_and_binary_number: [ OK ] 3.23 sec. 2026-03-09 10:35:01 02731_parallel_replicas_join_subquery: [ OK ] 1.68 sec. 2026-03-09 10:35:01 00882_multiple_join_no_alias: [ OK ] 0.62 sec. 2026-03-09 10:35:01 02932_kill_query_sleep: [ OK ] 3.73 sec. 2026-03-09 10:35:01 02047_log_family_complex_structs_data_file_dumps: [ OK ] 9.40 sec. 2026-03-09 10:35:02 00980_full_join_crash_fancyqlx: [ OK ] 0.52 sec. 2026-03-09 10:35:02 02097_remove_sample_by: [ OK ] 0.77 sec. 2026-03-09 10:35:02 00441_nulls_in: [ OK ] 0.62 sec. 2026-03-09 10:35:02 02154_bitmap_contains: [ OK ] 0.43 sec. 2026-03-09 10:35:02 00623_truncate_table: [ OK ] 0.92 sec. 2026-03-09 10:35:02 00734_timeslot: [ OK ] 0.62 sec. 2026-03-09 10:35:02 02935_format_with_arbitrary_types: [ OK ] 0.93 sec. 2026-03-09 10:35:03 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 0.72 sec. 2026-03-09 10:35:03 00623_in_partition_key: [ OK ] 1.08 sec. 2026-03-09 10:35:03 01079_bit_operations_using_bitset: [ OK ] 0.57 sec. 2026-03-09 10:35:03 02293_ttest_large_samples: [ OK ] 1.28 sec. 2026-03-09 10:35:03 01600_encode_XML: [ OK ] 0.47 sec. 2026-03-09 10:35:03 00355_array_of_non_const_convertible_types: [ OK ] 0.47 sec. 2026-03-09 10:35:04 03042_not_found_column_c1: [ OK ] 0.47 sec. 2026-03-09 10:35:04 02366_window_function_order_by: [ OK ] 0.48 sec. 2026-03-09 10:35:04 02674_date_int_string_json_inference: [ OK ] 0.42 sec. 2026-03-09 10:35:04 02833_tuple_concat: [ OK ] 0.62 sec. 2026-03-09 10:35:04 02922_server_exit_code: [ OK ] 1.02 sec. 2026-03-09 10:35:04 00719_insert_block_without_column: [ OK ] 2.68 sec. 2026-03-09 10:35:05 00608_uniq_array: [ OK ] 0.47 sec. 2026-03-09 10:35:05 00071_insert_fewer_columns: [ OK ] 0.47 sec. 2026-03-09 10:35:05 00311_array_primary_key: [ OK ] 0.62 sec. 2026-03-09 10:35:05 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 0.57 sec. 2026-03-09 10:35:05 00967_insert_into_distributed_different_types: [ OK ] 0.48 sec. 2026-03-09 10:35:05 01660_second_extremes_bug: [ OK ] 0.52 sec. 2026-03-09 10:35:06 01796_Log_rwlock_ub: [ OK ] 0.52 sec. 2026-03-09 10:35:06 02496_row_binary_large_string_size: [ OK ] 1.13 sec. 2026-03-09 10:35:06 02725_cnf_large_check: [ OK ] 0.73 sec. 2026-03-09 10:35:06 02439_merge_selecting_partitions: [ OK ] 4.54 sec. 2026-03-09 10:35:07 01268_mv_scalars: [ OK ] 0.79 sec. 2026-03-09 10:35:07 00960_eval_ml_method_const: [ OK ] 0.42 sec. 2026-03-09 10:35:07 02486_truncate_and_unexpected_parts: [ OK ] 1.57 sec. 2026-03-09 10:35:07 00740_database_in_nested_view: [ OK ] 0.52 sec. 2026-03-09 10:35:07 01825_type_json_schema_inference: [ OK ] 4.74 sec. 2026-03-09 10:35:07 01256_misspell_layout_name_podshumok: [ OK ] 0.42 sec. 2026-03-09 10:35:07 00022_func_higher_order_and_constants: [ OK ] 0.42 sec. 2026-03-09 10:35:07 01264_nested_baloo_bear: [ OK ] 0.47 sec. 2026-03-09 10:35:07 01825_new_type_json_in_array: [ OK ] 0.72 sec. 2026-03-09 10:35:07 02688_aggregate_states: [ OK ] 0.67 sec. 2026-03-09 10:35:07 01825_type_json_ephemeral: [ OK ] 0.52 sec. 2026-03-09 10:35:08 03162_dynamic_type_nested: [ OK ] 0.47 sec. 2026-03-09 10:35:08 01045_array_zip: [ OK ] 0.59 sec. 2026-03-09 10:35:08 01666_lcm_ubsan: [ OK ] 0.58 sec. 2026-03-09 10:35:08 01531_query_log_query_comment: [ OK ] 1.27 sec. 2026-03-09 10:35:08 01353_topk_enum: [ OK ] 0.43 sec. 2026-03-09 10:35:08 03060_analyzer_regular_view_alias: [ OK ] 0.52 sec. 2026-03-09 10:35:09 02560_window_ntile: [ OK ] 0.83 sec. 2026-03-09 10:35:09 03299_deep_nested_map_creation: [ OK ] 0.42 sec. 2026-03-09 10:35:10 01030_limit_by_with_ties_error: [ OK ] 2.28 sec. 2026-03-09 10:35:10 03167_fancy_quotes_off_by_one: [ OK ] 0.42 sec. 2026-03-09 10:35:11 00318_pk_tuple_order: [ OK ] 0.98 sec. 2026-03-09 10:35:11 01288_shard_max_network_bandwidth: [ OK ] 2.93 sec. 2026-03-09 10:35:11 02515_aggregate_functions_statistics: [ OK ] 0.68 sec. 2026-03-09 10:35:12 02293_http_header_full_summary_without_progress: [ OK ] 1.88 sec. 2026-03-09 10:35:12 00619_union_highlite: [ OK ] 0.47 sec. 2026-03-09 10:35:12 02677_grace_hash_limit_race: [ OK ] 0.57 sec. 2026-03-09 10:35:12 02021_create_database_with_comment: [ OK ] 4.44 sec. 2026-03-09 10:35:12 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.53 sec. 2026-03-09 10:35:12 02119_sumcount: [ OK ] 0.82 sec. 2026-03-09 10:35:13 03092_analyzer_same_table_name_in_different_databases: [ OK ] 0.47 sec. 2026-03-09 10:35:13 00534_functions_bad_arguments2: [ SKIPPED ] 0.00 sec. 2026-03-09 10:35:13 Reason: not running for current build 2026-03-09 10:35:13 01053_if_chain_check: [ OK ] 0.52 sec. 2026-03-09 10:35:13 01081_demangle: [ OK ] 0.42 sec. 2026-03-09 10:35:13 01664_array_slice_ubsan: [ OK ] 0.42 sec. 2026-03-09 10:35:13 01232_untuple: [ OK ] 0.62 sec. 2026-03-09 10:35:14 03036_test_parquet_bloom_filter_push_down: [ OK ] 11.01 sec. 2026-03-09 10:35:14 00626_replace_partition_from_table: [ OK ] 1.13 sec. 2026-03-09 10:35:14 02025_nested_func_for_if_combinator: [ OK ] 0.52 sec. 2026-03-09 10:35:14 02317_functions_with_nothing: [ OK ] 0.47 sec. 2026-03-09 10:35:15 02254_projection_broken_part: [ OK ] 7.20 sec. 2026-03-09 10:35:15 03036_dynamic_read_subcolumns_memory: [ OK ] 2.33 sec. 2026-03-09 10:35:15 02428_index_analysis_with_null_literal: [ OK ] 1.32 sec. 2026-03-09 10:35:15 02741_hashed_dictionary_load_factor: [ OK ] 1.47 sec. 2026-03-09 10:35:16 02394_every_profile_event_must_have_documentation: [ OK ] 0.42 sec. 2026-03-09 10:35:16 03222_datetime64_small_value_const: [ OK ] 0.98 sec. 2026-03-09 10:35:16 02444_async_broken_outdated_part_loading: [ OK ] 7.90 sec. 2026-03-09 10:35:17 02867_null_lc_in_bug: [ OK ] 0.62 sec. 2026-03-09 10:35:17 01602_runningConcurrency: [ OK ] 0.78 sec. 2026-03-09 10:35:17 03198_orc_read_time_zone: [ OK ] 2.68 sec. 2026-03-09 10:35:18 01651_map_functions: [ OK ] 1.18 sec. 2026-03-09 10:35:18 00909_arrayEnumerateUniq: [ OK ] 2.38 sec. 2026-03-09 10:35:19 01780_column_sparse_distinct: [ OK ] 0.52 sec. 2026-03-09 10:35:19 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 1.78 sec. 2026-03-09 10:35:19 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.52 sec. 2026-03-09 10:35:20 00449_filter_array_nullable_tuple: [ OK ] 0.53 sec. 2026-03-09 10:35:20 02967_parallel_replicas_joins_and_analyzer: [ OK ] 2.88 sec. 2026-03-09 10:35:21 01457_int256_hashing: [ OK ] 0.73 sec. 2026-03-09 10:35:21 00834_not_between: [ OK ] 0.48 sec. 2026-03-09 10:35:21 02751_query_log_test_partitions: [ OK ] 1.13 sec. 2026-03-09 10:35:22 03205_json_cast_from_string: [ OK ] 0.63 sec. 2026-03-09 10:35:22 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 1.03 sec. 2026-03-09 10:35:22 01944_insert_partition_by: [ OK ] 0.77 sec. 2026-03-09 10:35:23 03012_parser_backtracking: [ OK ] 7.40 sec. 2026-03-09 10:35:23 03167_base64_url_functions: [ OK ] 0.57 sec. 2026-03-09 10:35:23 02525_different_engines_in_temporary_tables: [ OK ] 0.68 sec. 2026-03-09 10:35:23 01602_modified_julian_day_msan: [ OK ] 0.58 sec. 2026-03-09 10:35:24 02481_async_insert_dedup_token: [ OK ] 93.62 sec. 2026-03-09 10:35:24 01675_distributed_bytes_to_delay_insert: [ OK ] 5.59 sec. 2026-03-09 10:35:24 01025_array_compact_generic: [ OK ] 0.52 sec. 2026-03-09 10:35:24 01550_mutation_subquery: [ OK ] 0.52 sec. 2026-03-09 10:35:24 02383_array_signed_const_positive_index: [ OK ] 0.57 sec. 2026-03-09 10:35:24 00901_joint_entropy: [ OK ] 0.47 sec. 2026-03-09 10:35:25 01358_mutation_delete_null_rows: [ OK ] 0.57 sec. 2026-03-09 10:35:25 03240_insert_select_named_tuple: [ OK ] 0.62 sec. 2026-03-09 10:35:25 02721_url_cluster: [ OK ] 1.02 sec. 2026-03-09 10:35:25 00252_shard_global_in_aggregate_function: [ OK ] 0.57 sec. 2026-03-09 10:35:25 02534_parquet_fixed_binary_array: [ OK ] 2.98 sec. 2026-03-09 10:35:26 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.47 sec. 2026-03-09 10:35:26 00003_reinterpret_as_string: [ OK ] 0.42 sec. 2026-03-09 10:35:26 02337_check_translate_qualified_names_matcher: [ OK ] 0.47 sec. 2026-03-09 10:35:26 00953_indices_alter_exceptions: [ OK ] 2.63 sec. 2026-03-09 10:35:26 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 0.53 sec. 2026-03-09 10:35:27 02988_join_using_prewhere_pushdown: [ OK ] 0.52 sec. 2026-03-09 10:35:27 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.48 sec. 2026-03-09 10:35:28 03246_json_simd_rapid_parsers: [ OK ] 1.53 sec. 2026-03-09 10:35:28 00555_right_join_excessive_rows: [ OK ] 0.42 sec. 2026-03-09 10:35:28 00465_nullable_default: [ OK ] 0.52 sec. 2026-03-09 10:35:28 02902_topKGeneric_deserialization_memory: [ OK ] 0.47 sec. 2026-03-09 10:35:29 02550_client_connections_credentials: [ OK ] 15.93 sec. 2026-03-09 10:35:29 02941_variant_type_2: [ OK ] 13.97 sec. 2026-03-09 10:35:29 00936_function_result_with_operator_in: [ OK ] 0.62 sec. 2026-03-09 10:35:29 01290_max_execution_speed_distributed: [ OK ] 3.18 sec. 2026-03-09 10:35:29 03039_recursive_cte_postgres_5: [ OK ] 0.67 sec. 2026-03-09 10:35:29 02869_unicode_minus: [ OK ] 0.47 sec. 2026-03-09 10:35:30 00997_trim: [ OK ] 0.93 sec. 2026-03-09 10:35:30 00131_set_hashed: [ OK ] 0.42 sec. 2026-03-09 10:35:30 02154_bit_slice_for_fixedstring: [ OK ] 1.27 sec. 2026-03-09 10:35:31 02290_client_insert_cancel: [ OK ] 1.47 sec. 2026-03-09 10:35:31 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.63 sec. 2026-03-09 10:35:31 02476_fuse_sum_count: [ OK ] 0.83 sec. 2026-03-09 10:35:31 02010_array_index_bad_cast: [ OK ] 0.47 sec. 2026-03-09 10:35:32 01685_json_extract_double_as_float: [ OK ] 0.52 sec. 2026-03-09 10:35:32 01633_limit_fuzz: [ OK ] 0.42 sec. 2026-03-09 10:35:32 00688_aggregation_retention: [ OK ] 0.67 sec. 2026-03-09 10:35:33 01230_join_get_truncate: [ OK ] 0.53 sec. 2026-03-09 10:35:33 02922_respect_nulls_Nullable: [ OK ] 0.72 sec. 2026-03-09 10:35:33 01049_join_low_card_crash: [ OK ] 0.63 sec. 2026-03-09 10:35:33 02376_analyzer_in_function_subquery: [ OK ] 0.62 sec. 2026-03-09 10:35:34 01273_arrow_decimal: [ OK ] 3.28 sec. 2026-03-09 10:35:34 03262_analyzer_materialized_view_in_with_cte: [ OK ] 0.53 sec. 2026-03-09 10:35:34 01528_to_uuid_or_null_or_zero: [ OK ] 0.67 sec. 2026-03-09 10:35:34 02423_insert_stats_behaviour: [ OK ] 5.85 sec. 2026-03-09 10:35:35 02436_system_zookeeper_context: [ OK ] 0.52 sec. 2026-03-09 10:35:35 03150_dynamic_type_mv_insert: [ OK ] 0.78 sec. 2026-03-09 10:35:35 02900_buffer_table_alter_race: [ OK ] 9.86 sec. 2026-03-09 10:35:35 01276_alter_rename_column_materialized_expr: [ OK ] 0.68 sec. 2026-03-09 10:35:36 01750_parsing_exception: [ OK ] 1.17 sec. 2026-03-09 10:35:36 02734_optimize_group_by: [ OK ] 0.62 sec. 2026-03-09 10:35:36 03093_with_fill_support_constant_expression: [ OK ] 0.42 sec. 2026-03-09 10:35:36 02210_processors_profile_log: [ OK ] 1.88 sec. 2026-03-09 10:35:36 01421_assert_in_in: [ OK ] 0.47 sec. 2026-03-09 10:35:37 02890_partition_prune_in_extra_columns: [ OK ] 0.47 sec. 2026-03-09 10:35:37 02811_invalid_embedded_rocksdb_create: [ OK ] 0.47 sec. 2026-03-09 10:35:37 01532_clickhouse_local_tmp_folder: [ OK ] 1.03 sec. 2026-03-09 10:35:37 02380_insert_mv_race: [ OK ] 2.43 sec. 2026-03-09 10:35:37 03142_alter_comment_parameterized_view: [ OK ] 0.52 sec. 2026-03-09 10:35:38 00564_versioned_collapsing_merge_tree: [ OK ] 8.65 sec. 2026-03-09 10:35:38 00007_array: [ OK ] 0.47 sec. 2026-03-09 10:35:38 02723_param_exception_message_context: [ OK ] 1.23 sec. 2026-03-09 10:35:38 00594_alias_in_distributed: [ OK ] 1.08 sec. 2026-03-09 10:35:39 02227_union_match_by_name: [ OK ] 0.47 sec. 2026-03-09 10:35:39 01430_modify_sample_by_zookeeper_long: [ OK ] 1.43 sec. 2026-03-09 10:35:39 00215_primary_key_order_zookeeper_long: [ OK ] 0.62 sec. 2026-03-09 10:35:40 02575_merge_prewhere_default_expression: [ OK ] 0.62 sec. 2026-03-09 10:35:40 01682_gather_utils_ubsan: [ OK ] 0.47 sec. 2026-03-09 10:35:40 02841_parallel_final_wrong_columns_order: [ OK ] 1.78 sec. 2026-03-09 10:35:40 02032_short_circuit_least_greatest_bug: [ OK ] 0.47 sec. 2026-03-09 10:35:40 00088_distinct_of_arrays_of_strings: [ OK ] 0.48 sec. 2026-03-09 10:35:40 02597_projection_materialize_and_replication: [ OK ] 1.58 sec. 2026-03-09 10:35:41 02336_sort_optimization_with_fill: [ OK ] 0.42 sec. 2026-03-09 10:35:41 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.47 sec. 2026-03-09 10:35:41 02121_pager: [ OK ] 1.33 sec. 2026-03-09 10:35:42 02981_translate_fixedstring: [ OK ] 0.47 sec. 2026-03-09 10:35:42 02952_clickhouse_local_query_parameters_cli: [ OK ] 0.98 sec. 2026-03-09 10:35:42 01585_fuzz_bits_with_bugfix: [ OK ] 0.42 sec. 2026-03-09 10:35:42 03100_analyzer_constants_in_multiif: [ OK ] 0.42 sec. 2026-03-09 10:35:43 01778_where_with_column_name: [ OK ] 0.53 sec. 2026-03-09 10:35:43 03208_array_of_json_read_subcolumns_1: [ OK ] 6.01 sec. 2026-03-09 10:35:43 00856_no_column_issue_4242: [ OK ] 0.52 sec. 2026-03-09 10:35:43 00825_protobuf_format_array_3dim: [ OK ] 2.83 sec. 2026-03-09 10:35:44 03168_fuzz_multiIf_short_circuit: [ OK ] 0.47 sec. 2026-03-09 10:35:44 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.42 sec. 2026-03-09 10:35:44 03228_variant_permutation_issue: [ OK ] 0.83 sec. 2026-03-09 10:35:44 03038_nested_dynamic_merges_compact_vertical: [ OK ] 4.14 sec. 2026-03-09 10:35:44 02176_optimize_aggregation_in_order_empty: [ OK ] 0.52 sec. 2026-03-09 10:35:45 02973_dictionary_table_exception_fix: [ OK ] 0.48 sec. 2026-03-09 10:35:45 01939_network_receive_bytes_metrics: [ OK ] 2.43 sec. 2026-03-09 10:35:45 02891_functions_over_sparse_columns: [ OK ] 0.52 sec. 2026-03-09 10:35:45 02353_compression_level: [ OK ] 11.16 sec. 2026-03-09 10:35:45 02302_clash_const_aggegate_join: [ OK ] 0.67 sec. 2026-03-09 10:35:46 02932_group_by_null_fuzzer: [ OK ] 0.57 sec. 2026-03-09 10:35:46 03034_dynamic_conversions: [ OK ] 0.82 sec. 2026-03-09 10:35:46 01118_is_constant: [ OK ] 0.52 sec. 2026-03-09 10:35:46 00819_ast_refactoring_bugs: [ OK ] 0.58 sec. 2026-03-09 10:35:46 01312_case_insensitive_regexp: [ OK ] 0.52 sec. 2026-03-09 10:35:46 01090_fixed_string_bit_ops: [ OK ] 0.47 sec. 2026-03-09 10:35:46 02986_leftpad_fixedstring: [ OK ] 0.57 sec. 2026-03-09 10:35:47 00389_concat_operator: [ OK ] 0.47 sec. 2026-03-09 10:35:47 02815_no_throw_in_simple_queries: [ FAIL ] 2.68 sec. 2026-03-09 10:35:47 Reason: return code: 1 2026-03-09 10:35:47 send: spawn id exp3 not open 2026-03-09 10:35:47 while executing 2026-03-09 10:35:47 "send -- "exit\r"" 2026-03-09 10:35:47 , result: 2026-03-09 10:35:47 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 2026-03-09 10:35:47 stdout: 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 Failed 2026-03-09 10:35:47 2026-03-09 10:35:47 2026-03-09 10:35:47 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 471080 --group_by_two_level_threshold_bytes 29954722 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 1 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 6372740 --max_read_buffer_size 763241 --prefer_localhost_replica 1 --max_block_size 29909 --max_joined_block_size_rows 89880 --max_threads 3 --optimize_append_index 1 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 31 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 4769813 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 8617408001 --min_bytes_to_use_mmap_io 7525535300 --local_filesystem_read_method io_uring --remote_filesystem_read_method read --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 10 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 0 --merge_tree_coarse_index_granularity 11 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 3074002116 --max_bytes_before_external_group_by 0 --max_bytes_before_remerge_sort 1321189875 --min_compress_block_size 3053229 --max_compress_block_size 2956812 --merge_tree_compact_parts_min_granules_to_multibuffer_read 117 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 7714739 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 0 --session_timezone America/Hermosillo --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.56 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 100000000 --cross_join_min_bytes_to_compress 100000000 --min_external_table_block_size_bytes 0 --max_parsing_threads 1 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 0 2026-03-09 10:35:47 2026-03-09 10:35:47 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.3802838036423216 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 1 --index_granularity_bytes 1994087 --merge_max_block_size 20252 --index_granularity 14214 --min_bytes_for_wide_part 522177254 --marks_compress_block_size 91479 --primary_key_compress_block_size 95660 --replace_long_file_name_to_hash 1 --max_file_name_length 101 --min_bytes_for_full_part_storage 483745894 --compact_parts_max_bytes_to_buffer 248804556 --compact_parts_max_granules_to_buffer 167 --compact_parts_merge_max_bytes_to_prefetch_part 31991159 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 100 --old_parts_lifetime 171 2026-03-09 10:35:47 2026-03-09 10:35:47 Database: test_6mlszt2j 2026-03-09 10:35:47 02025_having_filter_column: [ OK ] 0.47 sec. 2026-03-09 10:35:47 03276_functions_to_subcolumns_lc: [ OK ] 0.47 sec. 2026-03-09 10:35:47 01716_drop_rename_sign_column: [ OK ] 0.48 sec. 2026-03-09 10:35:47 02810_fix_remove_dedundant_distinct_view: [ OK ] 0.47 sec. 2026-03-09 10:35:47 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.47 sec. 2026-03-09 10:35:47 03209_json_type_horizontal_merges: [ SKIPPED ] 0.00 sec. 2026-03-09 10:35:47 Reason: not running for current build 2026-03-09 10:35:48 02714_date_date32_in: [ OK ] 0.47 sec. 2026-03-09 10:35:48 00717_merge_and_distributed: [ OK ] 1.33 sec. 2026-03-09 10:35:49 02335_column_ttl_expired_column_optimization: [ OK ] 1.38 sec. 2026-03-09 10:35:49 02884_parquet_new_encodings: [ OK ] 1.03 sec. 2026-03-09 10:35:49 02841_tuple_modulo: [ OK ] 0.47 sec. 2026-03-09 10:35:49 00024_unused_array_join_in_subquery: [ OK ] 0.43 sec. 2026-03-09 10:35:49 03119_analyzer_window_function_in_CTE_alias: [ OK ] 0.53 sec. 2026-03-09 10:35:49 02972_to_string_nullable_timezone: [ OK ] 0.47 sec. 2026-03-09 10:35:49 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 3.10 sec. 2026-03-09 10:35:50 03228_dynamic_serializations_uninitialized_value: [ OK ] 0.47 sec. 2026-03-09 10:35:50 02155_dictionary_comment: [ OK ] 0.78 sec. 2026-03-09 10:35:50 02024_join_on_or_long: [ OK ] 2.68 sec. 2026-03-09 10:35:50 02271_replace_partition_many_tables: [ OK ] 30.93 sec. 2026-03-09 10:35:50 01780_column_sparse_tuple: [ OK ] 0.77 sec. 2026-03-09 10:35:51 03274_format_inference_create_query_file: [ OK ] 1.58 sec. 2026-03-09 10:35:51 01509_dictionary_preallocate: [ OK ] 1.23 sec. 2026-03-09 10:35:51 00135_duplicate_group_by_keys_segfault: [ OK ] 0.17 sec. 2026-03-09 10:35:51 03023_invalid_format_detection: [ OK ] 1.07 sec. 2026-03-09 10:35:52 01551_mergetree_read_in_order_spread: [ OK ] 0.47 sec. 2026-03-09 10:35:52 02954_analyzer_fuzz_i57086: [ OK ] 0.52 sec. 2026-03-09 10:35:53 03199_has_lc_fixed_string: [ OK ] 0.47 sec. 2026-03-09 10:35:53 01001_enums_in_in_section: [ OK ] 0.47 sec. 2026-03-09 10:35:53 02908_table_ttl_dependency: [ OK ] 2.08 sec. 2026-03-09 10:35:54 02006_todatetime64_from_string: [ OK ] 0.47 sec. 2026-03-09 10:35:54 01710_minmax_count_projection_constant_query: [ OK ] 0.47 sec. 2026-03-09 10:35:55 02539_settings_alias: [ OK ] 4.18 sec. 2026-03-09 10:35:55 02841_group_array_sorted: [ OK ] 1.12 sec. 2026-03-09 10:35:55 01699_timezoneOffset: [ OK ] 0.82 sec. 2026-03-09 10:35:56 03215_parallel_replicas_crash_after_refactoring: [ OK ] 0.58 sec. 2026-03-09 10:35:57 02149_schema_inference_formats_with_schema_3: [ OK ] 3.48 sec. 2026-03-09 10:35:57 01119_session_log: [ OK ] 31.09 sec. 2026-03-09 10:35:57 03041_analyzer_gigachad_join: [ OK ] 0.53 sec. 2026-03-09 10:35:57 00411_long_accurate_number_comparison_int4: [ OK ] 6.25 sec. 2026-03-09 10:35:58 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.42 sec. 2026-03-09 10:35:58 02993_lazy_index_loading: [ OK ] 2.18 sec. 2026-03-09 10:35:59 01731_async_task_queue_wait: [ OK ] 3.28 sec. 2026-03-09 10:35:59 02833_local_udf_options: [ OK ] 1.13 sec. 2026-03-09 10:36:00 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.63 sec. 2026-03-09 10:36:00 02033_join_engine_deadlock_long: [ OK ] 3.33 sec. 2026-03-09 10:36:01 00008_array_join: [ OK ] 0.42 sec. 2026-03-09 10:36:01 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 1.98 sec. 2026-03-09 10:36:01 01273_arrow_arrays_load: [ OK ] 3.54 sec. 2026-03-09 10:36:01 02679_query_parameters_dangling_pointer: [ OK ] 0.47 sec. 2026-03-09 10:36:01 00931_low_cardinality_read_with_empty_array: [ OK ] 0.62 sec. 2026-03-09 10:36:01 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 0.52 sec. 2026-03-09 10:36:02 03073_analyzer_alias_as_column_name: [ OK ] 0.47 sec. 2026-03-09 10:36:02 01446_json_strings_each_row: [ OK ] 12.21 sec. 2026-03-09 10:36:02 02931_file_cluster: [ OK ] 1.23 sec. 2026-03-09 10:36:02 00662_array_has_nullable: [ OK ] 0.82 sec. 2026-03-09 10:36:02 02025_subcolumns_compact_parts: [ OK ] 0.53 sec. 2026-03-09 10:36:03 03015_with_fill_invalid_expression: [ OK ] 0.48 sec. 2026-03-09 10:36:03 00307_format_xml: [ OK ] 0.42 sec. 2026-03-09 10:36:03 01640_distributed_async_insert_compression: [ OK ] 0.47 sec. 2026-03-09 10:36:03 02184_ipv6_select_parsing: [ OK ] 0.47 sec. 2026-03-09 10:36:03 01051_window_view_parser_hop: [ OK ] 0.77 sec. 2026-03-09 10:36:03 00210_insert_select_extremes_http: [ OK ] 0.82 sec. 2026-03-09 10:36:03 02535_json_bson_each_row_curl: [ OK ] 2.73 sec. 2026-03-09 10:36:04 01657_array_element_ubsan: [ OK ] 0.53 sec. 2026-03-09 10:36:04 02572_query_views_log_background_thread: [ OK ] 14.22 sec. 2026-03-09 10:36:04 02990_format_not_precedence: [ OK ] 0.47 sec. 2026-03-09 10:36:04 01651_lc_insert_tiny_log_3: [ OK ] 5.69 sec. 2026-03-09 10:36:04 02178_column_function_insert_from: [ OK ] 0.52 sec. 2026-03-09 10:36:04 00647_multiply_aggregation_state: [ OK ] 0.68 sec. 2026-03-09 10:36:04 01514_empty_buffer_different_types: [ OK ] 0.57 sec. 2026-03-09 10:36:04 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 0.42 sec. 2026-03-09 10:36:05 01322_cast_keep_nullable: [ OK ] 0.57 sec. 2026-03-09 10:36:05 00416_pocopatch_progress_in_http_headers: [ OK ] 1.02 sec. 2026-03-09 10:36:05 01442_h3kring_range_check: [ OK ] 0.57 sec. 2026-03-09 10:36:05 01493_table_function_null: [ OK ] 0.42 sec. 2026-03-09 10:36:05 03165_parseReadableSize: [ OK ] 0.92 sec. 2026-03-09 10:36:05 02523_range_const_start: [ OK ] 0.47 sec. 2026-03-09 10:36:05 02941_variant_type_1: [ OK ] 21.31 sec. 2026-03-09 10:36:05 02999_variant_suspicious_types: [ OK ] 0.48 sec. 2026-03-09 10:36:05 02800_clickhouse_local_default_settings: [ OK ] 0.92 sec. 2026-03-09 10:36:05 02206_format_override: [ OK ] 1.68 sec. 2026-03-09 10:36:05 03207_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec. 2026-03-09 10:36:05 Reason: not running for current build 2026-03-09 10:36:06 00997_extract_all_crash_6627: [ OK ] 0.42 sec. 2026-03-09 10:36:06 02864_filtered_url_with_globs: [ OK ] 0.47 sec. 2026-03-09 10:36:06 00084_summing_merge_tree: [ OK ] 0.72 sec. 2026-03-09 10:36:06 02495_concat_with_separator: [ OK ] 0.93 sec. 2026-03-09 10:36:06 02133_issue_32458: [ OK ] 0.47 sec. 2026-03-09 10:36:06 01245_limit_infinite_sources: [ OK ] 1.18 sec. 2026-03-09 10:36:07 00753_comment_columns_zookeeper: [ OK ] 0.42 sec. 2026-03-09 10:36:07 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 3.98 sec. 2026-03-09 10:36:07 01700_system_zookeeper_path_in: [ OK ] 0.62 sec. 2026-03-09 10:36:07 00591_columns_removal_union_all: [ OK ] 0.47 sec. 2026-03-09 10:36:08 00192_least_greatest: [ OK ] 0.52 sec. 2026-03-09 10:36:08 02904_empty_order_by_with_setting_enabled: [ OK ] 2.08 sec. 2026-03-09 10:36:08 00393_if_with_constant_condition: [ OK ] 0.48 sec. 2026-03-09 10:36:09 01508_format_regexp_raw: [ OK ] 1.98 sec. 2026-03-09 10:36:09 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.47 sec. 2026-03-09 10:36:09 03273_dictionary_rbac: [ OK ] 3.43 sec. 2026-03-09 10:36:09 00999_settings_no_extra_quotes: [ OK ] 0.48 sec. 2026-03-09 10:36:09 02877_optimize_read_in_order_from_view: [ OK ] 3.83 sec. 2026-03-09 10:36:09 00688_low_cardinality_defaults: [ OK ] 0.42 sec. 2026-03-09 10:36:09 01710_projections_group_by_no_key: [ OK ] 0.55 sec. 2026-03-09 10:36:10 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.47 sec. 2026-03-09 10:36:10 02681_aggregation_by_partitions_bug: [ OK ] 0.52 sec. 2026-03-09 10:36:10 01813_quantileBfloat16_nans: [ OK ] 0.47 sec. 2026-03-09 10:36:10 01083_window_view_select: [ OK ] 4.04 sec. 2026-03-09 10:36:10 03001_block_offset_column_2: [ OK ] 0.58 sec. 2026-03-09 10:36:10 02967_parallel_replicas_join_algo_and_analyzer_1: [ OK ] 4.54 sec. 2026-03-09 10:36:10 00825_protobuf_format_nested_in_nested: [ OK ] 3.08 sec. 2026-03-09 10:36:11 00601_kill_running_query: [ OK ] 0.93 sec. 2026-03-09 10:36:11 02961_analyzer_low_cardinality_fuzzer: [ OK ] 0.62 sec. 2026-03-09 10:36:11 02027_ngrams: [ OK ] 0.62 sec. 2026-03-09 10:36:11 00422_hash_function_constexpr: [ OK ] 0.42 sec. 2026-03-09 10:36:11 01825_type_json_5: [ OK ] 0.52 sec. 2026-03-09 10:36:11 02457_morton_coding: [ OK ] 0.93 sec. 2026-03-09 10:36:11 00673_subquery_prepared_set_performance: [ OK ] 0.82 sec. 2026-03-09 10:36:12 02340_union_header: [ OK ] 0.53 sec. 2026-03-09 10:36:12 02158_ztest: [ OK ] 0.52 sec. 2026-03-09 10:36:12 00507_array_no_params: [ OK ] 1.93 sec. 2026-03-09 10:36:12 02783_date_predicate_optimizations: [ OK ] 1.93 sec. 2026-03-09 10:36:12 01354_order_by_tuple_collate_const: [ OK ] 0.42 sec. 2026-03-09 10:36:12 02718_parquet_metadata_format: [ OK ] 2.13 sec. 2026-03-09 10:36:12 01267_alter_default_key_columns_zookeeper_long: [ OK ] 0.78 sec. 2026-03-09 10:36:12 01458_is_decimal_overflow: [ OK ] 0.67 sec. 2026-03-09 10:36:12 01497_now_support_timezone: [ OK ] 0.47 sec. 2026-03-09 10:36:13 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 0.62 sec. 2026-03-09 10:36:13 01428_hash_set_nan_key: [ OK ] 0.47 sec. 2026-03-09 10:36:13 02812_subquery_operators: [ OK ] 0.47 sec. 2026-03-09 10:36:13 02160_special_functions: [ OK ] 0.77 sec. 2026-03-09 10:36:13 00232_format_readable_decimal_size: [ OK ] 0.42 sec. 2026-03-09 10:36:13 01073_bad_alter_partition: [ OK ] 0.77 sec. 2026-03-09 10:36:13 00172_constexprs_in_set: [ OK ] 0.48 sec. 2026-03-09 10:36:13 02536_date_from_number_inference_fix: [ OK ] 0.47 sec. 2026-03-09 10:36:13 02113_base64encode_trailing_bytes_1: [ OK ] 0.42 sec. 2026-03-09 10:36:14 03006_buffer_overflow_join: [ OK ] 0.47 sec. 2026-03-09 10:36:14 03171_direct_dict_short_circuit_bug: [ OK ] 0.52 sec. 2026-03-09 10:36:14 02944_variant_as_common_type_analyzer: [ OK ] 0.83 sec. 2026-03-09 10:36:14 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 6.09 sec. 2026-03-09 10:36:14 03003_database_filesystem_format_detection: [ OK ] 1.98 sec. 2026-03-09 10:36:15 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.58 sec. 2026-03-09 10:36:15 02813_array_agg: [ OK ] 0.52 sec. 2026-03-09 10:36:15 02832_transform_fixed_string_no_default: [ OK ] 0.52 sec. 2026-03-09 10:36:15 00841_temporary_table_database: [ OK ] 0.57 sec. 2026-03-09 10:36:15 02096_totals_global_in_bug: [ OK ] 0.58 sec. 2026-03-09 10:36:16 00975_json_hang: [ OK ] 0.62 sec. 2026-03-09 10:36:16 03040_dynamic_type_alters_1_memory: [ OK ] 0.82 sec. 2026-03-09 10:36:16 00513_fractional_time_zones: [ OK ] 0.42 sec. 2026-03-09 10:36:17 01881_join_on_conditions_hash: [ OK ] 2.18 sec. 2026-03-09 10:36:17 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 3.54 sec. 2026-03-09 10:36:17 01552_dict_fixedstring: [ OK ] 0.48 sec. 2026-03-09 10:36:17 03048_not_found_column_xxx_in_block: [ OK ] 0.57 sec. 2026-03-09 10:36:17 03034_recursive_cte_tree_fuzz_crash_fix: [ OK ] 0.78 sec. 2026-03-09 10:36:18 01143_trivial_count_with_join: [ OK ] 0.47 sec. 2026-03-09 10:36:18 02783_parallel_replicas_trivial_count_optimization: [ OK ] 4.74 sec. 2026-03-09 10:36:18 00471_sql_style_quoting: [ OK ] 0.48 sec. 2026-03-09 10:36:18 00447_foreach_modifier: [ OK ] 0.57 sec. 2026-03-09 10:36:19 00574_empty_strings_deserialization: [ OK ] 3.53 sec. 2026-03-09 10:36:19 02355_column_type_name_lc: [ OK ] 0.43 sec. 2026-03-09 10:36:19 02891_alter_update_adaptive_granularity: [ OK ] 0.53 sec. 2026-03-09 10:36:20 02998_http_redirects: [ OK ] 0.87 sec. 2026-03-09 10:36:21 00909_ngram_distance: [ OK ] 2.13 sec. 2026-03-09 10:36:21 03214_count_distinct_null_key_memory_leak: [ OK ] 3.13 sec. 2026-03-09 10:36:21 01945_show_debug_warning: [ OK ] 3.54 sec. 2026-03-09 10:36:22 02221_system_zookeeper_unrestricted_like: [ OK ] 4.49 sec. 2026-03-09 10:36:22 03258_old_analyzer_const_expr_bug: [ OK ] 0.42 sec. 2026-03-09 10:36:22 02267_type_inference_for_insert_into_function_null: [ OK ] 0.47 sec. 2026-03-09 10:36:22 00834_kill_mutation_replicated_zookeeper: [ SKIPPED ] 0.00 sec. 2026-03-09 10:36:22 Reason: not running for current build 2026-03-09 10:36:22 01600_quota_by_forwarded_ip: [ OK ] 1.83 sec. 2026-03-09 10:36:23 03080_analyzer_prefer_column_name_to_alias__virtual_columns: [ OK ] 0.47 sec. 2026-03-09 10:36:23 01317_no_password_in_command_line: [ OK ] 6.41 sec. 2026-03-09 10:36:23 00820_multiple_joins_subquery_requires_alias: [ OK ] 0.67 sec. 2026-03-09 10:36:23 02041_openssl_hash_functions_test: [ OK ] 0.47 sec. 2026-03-09 10:36:23 02988_ordinary_database_warning: [ OK ] 0.47 sec. 2026-03-09 10:36:24 02206_clickhouse_local_use_database: [ OK ] 0.98 sec. 2026-03-09 10:36:24 02020_cast_integer_overflow: [ OK ] 0.42 sec. 2026-03-09 10:36:24 01586_columns_pruning: [ OK ] 0.62 sec. 2026-03-09 10:36:24 02766_prql: [ OK ] 2.98 sec. 2026-03-09 10:36:24 01755_shard_pruning_with_literal: [ OK ] 0.53 sec. 2026-03-09 10:36:24 02006_use_constants_in_with_and_select: [ OK ] 0.47 sec. 2026-03-09 10:36:25 01416_join_totals_header_bug: [ OK ] 0.58 sec. 2026-03-09 10:36:25 00299_stripe_log_multiple_inserts: [ OK ] 0.78 sec. 2026-03-09 10:36:25 01680_date_time_add_ubsan: [ OK ] 0.58 sec. 2026-03-09 10:36:25 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.43 sec. 2026-03-09 10:36:25 02128_cast_nullable: [ OK ] 0.47 sec. 2026-03-09 10:36:26 01532_primary_key_without_order_by_zookeeper: [ OK ] 0.87 sec. 2026-03-09 10:36:26 01732_union_and_union_all: [ OK ] 0.47 sec. 2026-03-09 10:36:26 02971_analyzer_remote_id: [ OK ] 1.43 sec. 2026-03-09 10:36:27 01671_aggregate_function_group_bitmap_data: [ OK ] 0.52 sec. 2026-03-09 10:36:27 02224_parallel_distributed_insert_select_cluster: [ OK ] 0.62 sec. 2026-03-09 10:36:28 02043_user_defined_executable_function_implicit_cast: [ OK ] 1.23 sec. 2026-03-09 10:36:28 02041_test_fuzzy_alter: [ OK ] 0.48 sec. 2026-03-09 10:36:29 03037_dynamic_merges_2_vertical_compact_merge_tree: [ OK ] 0.93 sec. 2026-03-09 10:36:30 01710_order_by_projections_incomplete: [ OK ] 0.47 sec. 2026-03-09 10:36:30 00395_nullable: [ OK ] 5.64 sec. 2026-03-09 10:36:30 02122_parallel_formatting_JSONStrings: [ OK ] 4.49 sec. 2026-03-09 10:36:30 03243_create_or_replace_view_dependency_check: [ OK ] 0.48 sec. 2026-03-09 10:36:33 03250_SYSTEM_DROP_FORMAT_SCHEMA_CACHE_FOR_Protobuf: [ OK ] 21.59 sec. 2026-03-09 10:36:33 03199_unbin_buffer_overflow: [ OK ] 11.23 sec. 2026-03-09 10:36:33 02124_insert_deduplication_token: [ OK ] 0.63 sec. 2026-03-09 10:36:34 00726_length_aliases: [ OK ] 0.42 sec. 2026-03-09 10:36:34 01289_min_execution_speed_not_too_early: [ OK ] 1.22 sec. 2026-03-09 10:36:34 02962_analyzer_constant_set: [ OK ] 0.47 sec. 2026-03-09 10:36:34 01710_projections_optimize_aggregation_in_order: [ OK ] 7.45 sec. 2026-03-09 10:36:35 02319_dict_get_check_arguments_size: [ OK ] 0.73 sec. 2026-03-09 10:36:35 02565_analyzer_limit_settings: [ OK ] 0.62 sec. 2026-03-09 10:36:35 03033_cte_numbers_memory: [ OK ] 0.47 sec. 2026-03-09 10:36:35 02864_replace_regexp_string_fallback: [ OK ] 0.52 sec. 2026-03-09 10:36:35 02708_dotProduct: [ OK ] 1.07 sec. 2026-03-09 10:36:36 02269_bool_map_sync_after_error: [ OK ] 5.24 sec. 2026-03-09 10:36:36 02480_analyzer_alias_nullptr: [ OK ] 0.42 sec. 2026-03-09 10:36:36 01825_type_json_3: [ OK ] 0.82 sec. 2026-03-09 10:36:36 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 0.62 sec. 2026-03-09 10:36:36 01410_full_join_and_null_predicates: [ OK ] 0.72 sec. 2026-03-09 10:36:36 02842_filesystem_cache_validate_path: [ OK ] 0.52 sec. 2026-03-09 10:36:37 01710_projection_drop_if_exists: [ OK ] 0.52 sec. 2026-03-09 10:36:37 01532_having_with_totals: [ OK ] 0.62 sec. 2026-03-09 10:36:37 02233_with_total_empty_chunk: [ OK ] 0.47 sec. 2026-03-09 10:36:37 02357_query_cancellation_race: [ OK ] 6.81 sec. 2026-03-09 10:36:37 03011_adaptative_timeout_compatibility: [ OK ] 0.47 sec. 2026-03-09 10:36:37 02286_convert_decimal_type: [ OK ] 0.47 sec. 2026-03-09 10:36:37 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 23.92 sec. 2026-03-09 10:36:38 01770_add_months_ubsan: [ OK ] 0.42 sec. 2026-03-09 10:36:38 02295_GROUP_BY_AggregateFunction: [ OK ] 0.63 sec. 2026-03-09 10:36:38 01115_prewhere_array_join: [ OK ] 0.93 sec. 2026-03-09 10:36:38 01576_if_null_external_aggregation: [ OK ] 1.68 sec. 2026-03-09 10:36:39 01014_function_repeat_corner_cases: [ OK ] 0.58 sec. 2026-03-09 10:36:39 02921_bit_hamming_distance_big_int: [ OK ] 0.53 sec. 2026-03-09 10:36:39 01049_zookeeper_synchronous_mutations_long: [ OK ] 0.88 sec. 2026-03-09 10:36:40 01058_zlib_ng_level1_bug: [ OK ] 2.98 sec. 2026-03-09 10:36:40 03041_recursive_cte_postgres_7: [ OK ] 0.87 sec. 2026-03-09 10:36:40 02096_date_time_1970_saturation: [ OK ] 0.57 sec. 2026-03-09 10:36:41 01041_h3_is_valid: [ OK ] 0.47 sec. 2026-03-09 10:36:41 02731_replace_partition_from_temporary_table: [ OK ] 1.98 sec. 2026-03-09 10:36:41 02458_insert_select_progress_tcp: [ OK ] 3.64 sec. 2026-03-09 10:36:42 02285_hex_bin_support_more_types: [ OK ] 0.57 sec. 2026-03-09 10:36:42 01925_json_as_string_data_in_square_brackets: [ OK ] 0.52 sec. 2026-03-09 10:36:42 02840_merge__table_or_filter: [ OK ] 0.78 sec. 2026-03-09 10:36:43 02562_with_fill_nullable: [ OK ] 0.47 sec. 2026-03-09 10:36:43 02319_sql_standard_create_drop_index: [ OK ] 0.63 sec. 2026-03-09 10:36:44 03155_test_move_to_prewhere: [ OK ] 2.38 sec. 2026-03-09 10:36:44 00910_client_window_size_detection: [ OK ] 1.42 sec. 2026-03-09 10:36:44 02351_Map_combinator_dist: [ OK ] 0.67 sec. 2026-03-09 10:36:45 01581_deduplicate_by_columns_replicated_long: [ OK ] 1.03 sec. 2026-03-09 10:36:45 00957_neighbor: [ OK ] 0.93 sec. 2026-03-09 10:36:45 01388_multi_if_optimization: [ OK ] 0.47 sec. 2026-03-09 10:36:46 02907_preferred_optimize_projection_name: [ OK ] 8.05 sec. 2026-03-09 10:36:47 02482_value_block_parsing: [ OK ] 1.23 sec. 2026-03-09 10:36:47 01300_wkt: [ OK ] 0.67 sec. 2026-03-09 10:36:47 00105_shard_collations: [ OK ] 0.67 sec. 2026-03-09 10:36:48 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 0.57 sec. 2026-03-09 10:36:48 03269_partition_key_not_in_set: [ OK ] 0.87 sec. 2026-03-09 10:36:48 01825_type_json_ghdata: [ OK ] 7.90 sec. 2026-03-09 10:36:48 00568_empty_function_with_fixed_string: [ OK ] 0.53 sec. 2026-03-09 10:36:48 01648_mutations_and_escaping: [ OK ] 5.19 sec. 2026-03-09 10:36:49 00426_nulls_sorting: [ OK ] 0.62 sec. 2026-03-09 10:36:49 00978_sum_map_bugfix: [ OK ] 0.52 sec. 2026-03-09 10:36:49 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.43 sec. 2026-03-09 10:36:49 03155_datasketches_ubsan: [ OK ] 0.47 sec. 2026-03-09 10:36:49 00580_consistent_hashing_functions: [ OK ] 0.47 sec. 2026-03-09 10:36:50 01284_port: [ OK ] 0.82 sec. 2026-03-09 10:36:50 03032_storage_memory_modify_settings: [ OK ] 0.88 sec. 2026-03-09 10:36:50 01825_new_type_json_3: [ OK ] 0.98 sec. 2026-03-09 10:36:50 00450_higher_order_and_nullable: [ OK ] 0.42 sec. 2026-03-09 10:36:50 00956_join_use_nulls_with_array_column: [ OK ] 0.42 sec. 2026-03-09 10:36:51 00213_multiple_global_in: [ OK ] 0.47 sec. 2026-03-09 10:36:51 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 0.53 sec. 2026-03-09 10:36:51 02244_make_datetime: [ OK ] 0.78 sec. 2026-03-09 10:36:51 03142_untuple_crash: [ OK ] 0.42 sec. 2026-03-09 10:36:52 01520_client_print_query_id: [ OK ] 1.23 sec. 2026-03-09 10:36:52 01865_aggregator_overflow_row: [ OK ] 0.58 sec. 2026-03-09 10:36:52 02500_remove_redundant_distinct_analyzer: [ OK ] 16.17 sec. 2026-03-09 10:36:52 03135_keeper_client_find_commands: [ OK ] 1.73 sec. 2026-03-09 10:36:53 01274_alter_rename_column_distributed: [ OK ] 0.57 sec. 2026-03-09 10:36:53 02353_ascii: [ OK ] 0.47 sec. 2026-03-09 10:36:53 00900_orc_arrow_parquet_tuples: [ OK ] 7.35 sec. 2026-03-09 10:36:53 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.47 sec. 2026-03-09 10:36:53 01096_block_serialized_state: [ OK ] 0.42 sec. 2026-03-09 10:36:53 01502_bar_overflow: [ OK ] 0.72 sec. 2026-03-09 10:36:53 00908_bloom_filter_index: [ OK ] 23.56 sec. 2026-03-09 10:36:54 02815_fix_not_found_constants_col_in_block: [ OK ] 0.47 sec. 2026-03-09 10:36:54 01032_cityHash64_for_UUID: [ OK ] 0.52 sec. 2026-03-09 10:36:54 02136_kill_scalar_queries: [ OK ] 1.73 sec. 2026-03-09 10:36:54 00578_merge_table_and_table_virtual_column: [ OK ] 0.82 sec. 2026-03-09 10:36:54 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 1.12 sec. 2026-03-09 10:36:55 03160_dynamic_type_agg: [ OK ] 0.48 sec. 2026-03-09 10:36:55 02392_every_setting_must_have_documentation: [ OK ] 0.42 sec. 2026-03-09 10:36:55 00296_url_parameters: [ OK ] 0.68 sec. 2026-03-09 10:36:55 00942_mv_rename_table: [ OK ] 0.52 sec. 2026-03-09 10:36:55 02575_map_hashing_msan: [ OK ] 0.53 sec. 2026-03-09 10:36:55 00492_drop_temporary_table: [ OK ] 0.47 sec. 2026-03-09 10:36:56 02095_function_get_os_kernel_version: [ OK ] 0.42 sec. 2026-03-09 10:36:56 01822_union_and_constans_error: [ OK ] 0.52 sec. 2026-03-09 10:36:56 02932_query_settings_max_size_drop: [ OK ] 0.67 sec. 2026-03-09 10:36:56 01502_jemalloc_percpu_arena: [ SKIPPED ] 0.00 sec. 2026-03-09 10:36:56 Reason: not running for current build 2026-03-09 10:36:56 02267_file_globs_schema_inference: [ OK ] 3.68 sec. 2026-03-09 10:36:56 01476_right_full_join_switch: [ OK ] 0.67 sec. 2026-03-09 10:36:57 01678_great_circle_angle: [ OK ] 0.53 sec. 2026-03-09 10:36:57 00720_with_cube: [ OK ] 0.67 sec. 2026-03-09 10:36:57 02480_suspicious_lowcard_in_key: [ OK ] 0.53 sec. 2026-03-09 10:36:57 01072_drop_temporary_table_with_same_name: [ OK ] 0.52 sec. 2026-03-09 10:36:57 01710_projection_external_aggregate: [ OK ] 0.57 sec. 2026-03-09 10:36:57 00055_join_two_numbers: [ OK ] 0.42 sec. 2026-03-09 10:36:58 02493_analyzer_sum_if_to_count_if: [ OK ] 0.52 sec. 2026-03-09 10:36:58 01523_interval_operator_support_string_literal: [ OK ] 0.57 sec. 2026-03-09 10:36:58 01456_modify_column_type_via_add_drop_update: [ OK ] 1.07 sec. 2026-03-09 10:36:59 00966_invalid_json_must_not_parse: [ OK ] 0.53 sec. 2026-03-09 10:36:59 02414_all_new_table_functions_must_be_documented: [ OK ] 0.42 sec. 2026-03-09 10:36:59 02043_query_obfuscator_embedded_dictionaries: [ OK ] 0.83 sec. 2026-03-09 10:36:59 00999_join_not_nullable_types: [ OK ] 0.47 sec. 2026-03-09 10:36:59 01305_polygons_union: [ OK ] 0.73 sec. 2026-03-09 10:36:59 02734_sparse_columns_short_circuit: [ OK ] 0.63 sec. 2026-03-09 10:37:00 03263_analyzer_materialized_view_cte_nested: [ OK ] 0.52 sec. 2026-03-09 10:37:00 01845_add_testcase_for_arrayElement: [ OK ] 0.53 sec. 2026-03-09 10:37:00 02104_clickhouse_local_columns_description: [ OK ] 1.03 sec. 2026-03-09 10:37:00 01287_max_execution_speed: [ OK ] 4.59 sec. 2026-03-09 10:37:01 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.42 sec. 2026-03-09 10:37:01 01595_countMatches: [ OK ] 0.83 sec. 2026-03-09 10:37:01 02746_index_analysis_binary_operator_with_null: [ OK ] 0.52 sec. 2026-03-09 10:37:02 02675_grant_query_formatting: [ OK ] 0.88 sec. 2026-03-09 10:37:02 02597_column_delete_and_replication: [ OK ] 1.68 sec. 2026-03-09 10:37:02 02999_scalar_subqueries_bug_2: [ OK ] 0.52 sec. 2026-03-09 10:37:02 02475_join_bug_42832: [ OK ] 0.58 sec. 2026-03-09 10:37:03 00372_cors_header: [ OK ] 0.82 sec. 2026-03-09 10:37:03 00934_is_valid_utf8: [ OK ] 0.95 sec. 2026-03-09 10:37:03 01390_remove_injective_in_uniq: [ OK ] 0.63 sec. 2026-03-09 10:37:04 01549_low_cardinality_materialized_view: [ OK ] 0.52 sec. 2026-03-09 10:37:04 02563_async_insert_bad_data: [ OK ] 2.43 sec. 2026-03-09 10:37:05 01125_generate_random_qoega: [ OK ] 1.13 sec. 2026-03-09 10:37:05 02366_kql_operator_in_sql: [ OK ] 0.98 sec. 2026-03-09 10:37:06 03077_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.58 sec. 2026-03-09 10:37:07 02265_column_ttl: [ OK ] 1.06 sec. 2026-03-09 10:37:07 00942_dataparts_500: [ OK ] 0.94 sec. 2026-03-09 10:37:07 01954_clickhouse_benchmark_multiple_long: [ OK ] 12.58 sec. 2026-03-09 10:37:07 01603_read_with_backoff_bug: [ OK ] 18.35 sec. 2026-03-09 10:37:07 02013_emptystring_cast: [ OK ] 0.52 sec. 2026-03-09 10:37:08 03215_parquet_index: [ OK ] 0.52 sec. 2026-03-09 10:37:08 03198_bit_shift_throws_error_for_out_of_bounds: [ OK ] 0.77 sec. 2026-03-09 10:37:08 00585_union_all_subquery_aggregation_column_removal: [ OK ] 0.57 sec. 2026-03-09 10:37:08 00500_point_in_polygon_non_const_poly: [ OK ] 1.38 sec. 2026-03-09 10:37:08 01513_defaults_on_defaults_no_column: [ OK ] 0.48 sec. 2026-03-09 10:37:08 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 0.47 sec. 2026-03-09 10:37:08 02514_bad_index_granularity: [ OK ] 0.42 sec. 2026-03-09 10:37:09 01011_group_uniq_array_memsan: [ OK ] 0.42 sec. 2026-03-09 10:37:09 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 0.77 sec. 2026-03-09 10:37:09 01774_tuple_null_in: [ OK ] 0.47 sec. 2026-03-09 10:37:09 02876_yyyymmddhhmmsstodatetime: [ OK ] 1.32 sec. 2026-03-09 10:37:09 01089_alter_settings_old_format: [ OK ] 0.42 sec. 2026-03-09 10:37:09 00712_prewhere_with_alias: [ OK ] 0.62 sec. 2026-03-09 10:37:09 02347_rank_corr_nan: [ OK ] 0.42 sec. 2026-03-09 10:37:10 01318_alter_add_column_exists: [ OK ] 0.42 sec. 2026-03-09 10:37:10 00854_multiple_join_asterisks: [ OK ] 0.52 sec. 2026-03-09 10:37:10 00251_has_types: [ OK ] 0.52 sec. 2026-03-09 10:37:10 01411_xor_itai_shirav: [ OK ] 0.42 sec. 2026-03-09 10:37:11 02481_pk_analysis_with_enum_to_string: [ OK ] 0.67 sec. 2026-03-09 10:37:11 02864_statistics_delayed_materialization_in_merge: [ OK ] 0.67 sec. 2026-03-09 10:37:11 02494_parser_string_binary_literal: [ OK ] 0.52 sec. 2026-03-09 10:37:11 01518_select_in_null: [ OK ] 1.33 sec. 2026-03-09 10:37:12 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 0.47 sec. 2026-03-09 10:37:12 01949_heredoc_unfinished: [ OK ] 0.82 sec. 2026-03-09 10:37:12 02475_analysis_of_variance: [ OK ] 0.57 sec. 2026-03-09 10:37:13 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.47 sec. 2026-03-09 10:37:13 02992_all_columns_should_have_comment: [ OK ] 0.72 sec. 2026-03-09 10:37:13 00963_startsWith_force_primary_key: [ OK ] 0.48 sec. 2026-03-09 10:37:13 03039_unknown_identifier_window_function: [ OK ] 0.42 sec. 2026-03-09 10:37:14 01582_distinct_subquery_groupby: [ OK ] 0.62 sec. 2026-03-09 10:37:14 03001_data_version_column: [ OK ] 0.57 sec. 2026-03-09 10:37:14 00825_protobuf_format_persons: [ OK ] 10.91 sec. 2026-03-09 10:37:14 01825_new_type_json_8: [ OK ] 5.09 sec. 2026-03-09 10:37:15 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 0.47 sec. 2026-03-09 10:37:15 01059_storage_file_compression: [ OK ] 21.46 sec. 2026-03-09 10:37:15 03033_lightweight_deletes_sync: [ OK ] 0.52 sec. 2026-03-09 10:37:15 01064_pm_all_join_const_and_nullable: [ OK ] 0.87 sec. 2026-03-09 10:37:15 02577_analyzer_array_join_calc_twice: [ OK ] 0.47 sec. 2026-03-09 10:37:16 02922_respect_nulls_parser: [ OK ] 0.68 sec. 2026-03-09 10:37:16 02184_storage_add_support_ttl: [ OK ] 0.62 sec. 2026-03-09 10:37:16 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 0.62 sec. 2026-03-09 10:37:17 02801_backup_native_copy: [ OK ] 6.35 sec. 2026-03-09 10:37:17 02310_generate_multi_columns_with_uuid: [ OK ] 0.55 sec. 2026-03-09 10:37:17 01882_total_rows_approx: [ OK ] 2.13 sec. 2026-03-09 10:37:17 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.47 sec. 2026-03-09 10:37:18 01032_duplicate_column_insert_query: [ OK ] 0.53 sec. 2026-03-09 10:37:18 00900_orc_arrays_load: [ OK ] 3.73 sec. 2026-03-09 10:37:18 00346_if_tuple: [ OK ] 0.67 sec. 2026-03-09 10:37:18 01055_prewhere_bugs: [ OK ] 0.52 sec. 2026-03-09 10:37:19 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 1.07 sec. 2026-03-09 10:37:19 03226_alter_update_dynamic_json_not_supported: [ OK ] 0.47 sec. 2026-03-09 10:37:19 01670_test_repeat_mysql_dialect: [ OK ] 0.42 sec. 2026-03-09 10:37:20 01412_group_array_moving_shard: [ OK ] 0.78 sec. 2026-03-09 10:37:20 02352_grouby_shadows_arg: [ OK ] 0.52 sec. 2026-03-09 10:37:21 01018_Distributed__shard_num: [ OK ] 1.03 sec. 2026-03-09 10:37:22 00308_write_buffer_valid_utf8: [ OK ] 0.42 sec. 2026-03-09 10:37:22 03001_backup_matview_after_modify_query: [ OK ] 4.64 sec. 2026-03-09 10:37:22 03003_functions_to_subcolumns_final: [ OK ] 0.62 sec. 2026-03-09 10:37:23 01070_alter_with_ttl: [ OK ] 0.42 sec. 2026-03-09 10:37:23 01605_skip_idx_compact_parts: [ OK ] 0.58 sec. 2026-03-09 10:37:24 00508_materialized_view_to: [ OK ] 0.47 sec. 2026-03-09 10:37:24 02451_variadic_null_garbage_data: [ OK ] 0.63 sec. 2026-03-09 10:37:25 02247_read_bools_as_numbers_json: [ OK ] 8.85 sec. 2026-03-09 10:37:25 01083_aggregation_memory_efficient_bug: [ OK ] 0.67 sec. 2026-03-09 10:37:25 01444_create_table_drop_database_race: [ OK ] 11.06 sec. 2026-03-09 10:37:25 00298_enum_width_and_cast: [ OK ] 0.53 sec. 2026-03-09 10:37:26 02971_functions_to_subcolumns_map: [ OK ] 0.48 sec. 2026-03-09 10:37:26 02294_decimal_second_errors: [ OK ] 0.47 sec. 2026-03-09 10:37:26 02560_vertical_merge_memory_usage: [ OK ] 2.93 sec. 2026-03-09 10:37:26 02344_distinct_limit_distiributed: [ OK ] 1.18 sec. 2026-03-09 10:37:26 01665_substring_ubsan: [ OK ] 0.47 sec. 2026-03-09 10:37:26 01098_sum: [ OK ] 0.58 sec. 2026-03-09 10:37:27 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 0.52 sec. 2026-03-09 10:37:27 02916_csv_infer_numbers_from_strings: [ OK ] 0.42 sec. 2026-03-09 10:37:27 00847_multiple_join_same_column: [ OK ] 0.83 sec. 2026-03-09 10:37:27 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 8.20 sec. 2026-03-09 10:37:27 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 0.62 sec. 2026-03-09 10:37:27 00322_disable_checksumming: [ OK ] 0.72 sec. 2026-03-09 10:37:28 00487_if_array_fixed_string: [ OK ] 0.42 sec. 2026-03-09 10:37:28 02424_pod_array_overflow: [ OK ] 0.42 sec. 2026-03-09 10:37:28 02582_async_reading_with_small_limit: [ OK ] 0.52 sec. 2026-03-09 10:37:28 00534_functions_bad_arguments12: [ SKIPPED ] 0.00 sec. 2026-03-09 10:37:28 Reason: not running for current build 2026-03-09 10:37:28 02122_parallel_formatting_TSV: [ OK ] 2.63 sec. 2026-03-09 10:37:28 00553_buff_exists_materlized_column: [ OK ] 0.52 sec. 2026-03-09 10:37:28 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 1.08 sec. 2026-03-09 10:37:29 01548_with_totals_having: [ OK ] 0.42 sec. 2026-03-09 10:37:29 01710_projection_optimize_group_by_function_keys: [ OK ] 0.47 sec. 2026-03-09 10:37:29 01013_totals_without_aggregation: [ OK ] 0.52 sec. 2026-03-09 10:37:29 03289_explain_syntax_statistics: [ OK ] 0.42 sec. 2026-03-09 10:37:29 01049_window_view_window_functions: [ OK ] 0.82 sec. 2026-03-09 10:37:30 02017_columns_with_dot_2: [ OK ] 0.52 sec. 2026-03-09 10:37:30 01273_lc_fixed_string_field: [ OK ] 0.52 sec. 2026-03-09 10:37:30 02896_leading_zeroes_no_octal: [ OK ] 2.73 sec. 2026-03-09 10:37:30 02901_analyzer_recursive_window: [ OK ] 0.47 sec. 2026-03-09 10:37:30 01042_check_query_and_last_granule_size: [ OK ] 0.62 sec. 2026-03-09 10:37:31 02890_describe_table_options: [ OK ] 0.57 sec. 2026-03-09 10:37:31 02702_allow_skip_errors_enum: [ OK ] 2.33 sec. 2026-03-09 10:37:32 03041_select_with_query_result: [ OK ] 0.62 sec. 2026-03-09 10:37:32 01903_correct_block_size_prediction_with_default: [ OK ] 14.12 sec. 2026-03-09 10:37:33 03169_display_column_names_in_footer: [ OK ] 0.67 sec. 2026-03-09 10:37:33 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.63 sec. 2026-03-09 10:37:33 01513_optimize_aggregation_in_order_memory_long: [ OK ] 4.38 sec. 2026-03-09 10:37:33 01838_system_dictionaries_virtual_key_column: [ OK ] 0.52 sec. 2026-03-09 10:37:33 02933_group_by_memory_usage: [ OK ] 2.53 sec. 2026-03-09 10:37:34 01071_window_view_event_tumble_asc_join: [ OK ] 3.84 sec. 2026-03-09 10:37:34 01661_week_functions_string_args: [ OK ] 0.77 sec. 2026-03-09 10:37:34 02267_special_operator_parse_alias_check: [ OK ] 0.82 sec. 2026-03-09 10:37:34 00098_f_union_all: [ OK ] 0.52 sec. 2026-03-09 10:37:34 02995_index_10: [ SKIPPED ] 0.00 sec. 2026-03-09 10:37:34 Reason: not running for current build 2026-03-09 10:37:34 00052_all_left_join: [ OK ] 0.47 sec. 2026-03-09 10:37:34 00334_column_aggregate_function_limit: [ OK ] 0.48 sec. 2026-03-09 10:37:34 01084_defaults_on_aliases: [ OK ] 0.63 sec. 2026-03-09 10:37:35 02831_trash: [ OK ] 0.42 sec. 2026-03-09 10:37:35 00530_arrays_of_nothing: [ OK ] 0.47 sec. 2026-03-09 10:37:35 00484_preferred_max_column_in_block_size_bytes: [ OK ] 1.63 sec. 2026-03-09 10:37:35 00340_squashing_insert_select: [ OK ] 1.39 sec. 2026-03-09 10:37:36 01414_low_cardinality_nullable: [ OK ] 1.53 sec. 2026-03-09 10:37:37 03167_base64_url_functions_sh: [ OK ] 75.78 sec. 2026-03-09 10:37:37 03202_dynamic_null_map_subcolumn: [ OK ] 1.78 sec. 2026-03-09 10:37:37 01065_if_not_finite: [ OK ] 0.57 sec. 2026-03-09 10:37:37 01497_mutation_support_for_storage_memory: [ OK ] 0.52 sec. 2026-03-09 10:37:38 00400_client_external_options: [ OK ] 2.80 sec. 2026-03-09 10:37:38 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.43 sec. 2026-03-09 10:37:38 00910_buffer_prewhere: [ OK ] 0.47 sec. 2026-03-09 10:37:38 01825_new_type_json_9: [ OK ] 0.52 sec. 2026-03-09 10:37:38 00650_csv_with_specified_quote_rule: [ OK ] 8.05 sec. 2026-03-09 10:37:39 01034_values_parse_float_bug: [ OK ] 3.13 sec. 2026-03-09 10:37:39 02967_index_hint_crash: [ OK ] 0.47 sec. 2026-03-09 10:37:39 01389_filter_by_virtual_columns: [ OK ] 0.47 sec. 2026-03-09 10:37:39 00900_long_parquet: [ OK ] 38.42 sec. 2026-03-09 10:37:39 02098_date32_comparison: [ OK ] 0.57 sec. 2026-03-09 10:37:39 02995_index_5: [ SKIPPED ] 0.00 sec. 2026-03-09 10:37:39 Reason: not running for current build 2026-03-09 10:37:39 03151_pmj_join_non_procssed_clash: [ OK ] 0.67 sec. 2026-03-09 10:37:39 01550_query_identifier_parameters: [ OK ] 2.68 sec. 2026-03-09 10:37:39 03164_early_constant_folding_analyzer: [ OK ] 0.47 sec. 2026-03-09 10:37:40 02475_precise_decimal_arithmetics: [ OK ] 0.72 sec. 2026-03-09 10:37:40 01492_format_readable_quantity: [ OK ] 0.42 sec. 2026-03-09 10:37:40 02433_default_expression_operator_in: [ OK ] 0.57 sec. 2026-03-09 10:37:40 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.47 sec. 2026-03-09 10:37:40 03215_validate_type_in_alter_add_modify_column: [ OK ] 0.62 sec. 2026-03-09 10:37:40 00700_decimal_empty_aggregates: [ OK ] 1.13 sec. 2026-03-09 10:37:41 02592_avro_records_with_same_names: [ OK ] 0.87 sec. 2026-03-09 10:37:41 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.47 sec. 2026-03-09 10:37:41 02675_sparse_columns_clear_column: [ OK ] 1.12 sec. 2026-03-09 10:37:41 00725_join_on_bug_4: [ OK ] 0.52 sec. 2026-03-09 10:37:41 01710_normal_projection_format: [ OK ] 0.42 sec. 2026-03-09 10:37:42 01273_arrow_load: [ OK ] 2.64 sec. 2026-03-09 10:37:42 02875_parallel_replicas_cluster_all_replicas: [ OK ] 0.98 sec. 2026-03-09 10:37:42 02235_add_part_offset_virtual_column: [ OK ] 1.22 sec. 2026-03-09 10:37:42 00910_decimal_group_array_crash_3783: [ OK ] 0.62 sec. 2026-03-09 10:37:43 01176_mysql_client_interactive: [ OK ] 1.48 sec. 2026-03-09 10:37:43 02126_fix_filelog: [ OK ] 2.99 sec. 2026-03-09 10:37:43 01686_rocksdb: [ OK ] 0.87 sec. 2026-03-09 10:37:43 01866_view_persist_settings: [ OK ] 1.03 sec. 2026-03-09 10:37:43 01937_nested_chinese: [ OK ] 0.47 sec. 2026-03-09 10:37:43 02791_final_block_structure_mismatch_bug: [ OK ] 0.82 sec. 2026-03-09 10:37:44 03237_max_map_state_decimal_serialization: [ OK ] 0.42 sec. 2026-03-09 10:37:44 03032_variant_bool_number_not_suspicious: [ OK ] 0.42 sec. 2026-03-09 10:37:44 00535_parse_float_scientific: [ OK ] 0.47 sec. 2026-03-09 10:37:44 01353_neighbor_overflow: [ OK ] 0.52 sec. 2026-03-09 10:37:44 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.42 sec. 2026-03-09 10:37:45 01440_big_int_shift: [ OK ] 0.43 sec. 2026-03-09 10:37:45 01781_token_extractor_buffer_overflow: [ OK ] 0.82 sec. 2026-03-09 10:37:45 03032_save_bad_json_escape_sequences: [ OK ] 0.42 sec. 2026-03-09 10:37:45 02003_memory_limit_in_client: [ OK ] 8.40 sec. 2026-03-09 10:37:45 02920_alter_column_of_projections: [ OK ] 0.62 sec. 2026-03-09 10:37:45 03095_merge_and_buffer_tables: [ OK ] 0.58 sec. 2026-03-09 10:37:45 02142_http_with_query_parameters: [ OK ] 0.88 sec. 2026-03-09 10:37:46 03010_view_prewhere_in: [ OK ] 0.53 sec. 2026-03-09 10:37:47 02592_avro_more_types: [ OK ] 1.58 sec. 2026-03-09 10:37:48 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 2.45 sec. 2026-03-09 10:37:48 00725_join_on_bug_2: [ OK ] 0.65 sec. 2026-03-09 10:37:49 00667_compare_arrays_of_different_types: [ OK ] 0.47 sec. 2026-03-09 10:37:49 01710_projection_array_join: [ OK ] 0.52 sec. 2026-03-09 10:37:49 03209_json_type_merges_small: [ SKIPPED ] 0.00 sec. 2026-03-09 10:37:49 Reason: not running for current build 2026-03-09 10:37:50 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.42 sec. 2026-03-09 10:37:50 02968_full_sorting_join_fuzz: [ OK ] 5.05 sec. 2026-03-09 10:37:51 02122_parallel_formatting_JSONCompact: [ OK ] 2.88 sec. 2026-03-09 10:37:51 01915_json_extract_raw_string: [ OK ] 0.47 sec. 2026-03-09 10:37:52 01518_filtering_aliased_materialized_column: [ OK ] 0.53 sec. 2026-03-09 10:37:52 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 6.50 sec. 2026-03-09 10:37:52 01055_compact_parts_1: [ OK ] 0.45 sec. 2026-03-09 10:37:52 02715_or_null: [ OK ] 0.47 sec. 2026-03-09 10:37:53 00603_system_parts_nonexistent_database: [ OK ] 0.42 sec. 2026-03-09 10:37:53 00276_sample: [ OK ] 2.49 sec. 2026-03-09 10:37:53 00760_insert_json_with_defaults: [ OK ] 0.65 sec. 2026-03-09 10:37:53 01509_check_many_parallel_quorum_inserts_long: [ OK ] 9.82 sec. 2026-03-09 10:37:54 02918_analyzer_to_ast_crash: [ OK ] 0.48 sec. 2026-03-09 10:37:54 02111_with_fill_no_rows: [ OK ] 0.54 sec. 2026-03-09 10:37:54 01293_show_settings: [ OK ] 0.18 sec. 2026-03-09 10:37:54 01951_distributed_push_down_limit: [ OK ] 0.48 sec. 2026-03-09 10:37:55 02251_alter_enum_nested_struct: [ OK ] 0.58 sec. 2026-03-09 10:37:55 02816_check_projection_metadata: [ OK ] 0.52 sec. 2026-03-09 10:37:55 01338_long_select_and_alter: [ OK ] 14.48 sec. 2026-03-09 10:37:55 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 0.53 sec. 2026-03-09 10:37:56 02381_join_dup_columns_in_plan: [ OK ] 0.84 sec. 2026-03-09 10:37:56 02497_having_without_actual_aggregation_bug: [ OK ] 0.53 sec. 2026-03-09 10:37:56 03152_analyzer_columns_list: [ OK ] 0.53 sec. 2026-03-09 10:37:57 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 4.24 sec. 2026-03-09 10:37:57 02883_read_in_reverse_order_virtual_column: [ OK ] 1.23 sec. 2026-03-09 10:37:57 00204_extract_url_parameter: [ OK ] 0.54 sec. 2026-03-09 10:37:57 02015_async_inserts_7: [ OK ] 2.60 sec. 2026-03-09 10:37:58 02149_schema_inference: [ OK ] 23.47 sec. 2026-03-09 10:37:58 02792_drop_projection_lwd: [ OK ] 0.58 sec. 2026-03-09 10:37:58 02243_in_ip_address: [ OK ] 0.52 sec. 2026-03-09 10:37:58 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 0.60 sec. 2026-03-09 10:37:58 02267_insert_empty_data: [ OK ] 0.49 sec. 2026-03-09 10:37:58 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.60 sec. 2026-03-09 10:37:58 00729_prewhere_array_join: [ OK ] 0.80 sec. 2026-03-09 10:37:59 02674_trivial_count_analyzer: [ OK ] 0.88 sec. 2026-03-09 10:37:59 01068_parens: [ OK ] 0.44 sec. 2026-03-09 10:37:59 03210_empty_tuple_lhs_of_in: [ OK ] 0.48 sec. 2026-03-09 10:37:59 02488_zero_copy_detached_parts_drop_table: [ OK ] 6.15 sec. 2026-03-09 10:37:59 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.59 sec. 2026-03-09 10:37:59 03208_numbers_total_rows_approx: [ OK ] 0.49 sec. 2026-03-09 10:38:00 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 0.93 sec. 2026-03-09 10:38:00 00173_compare_date_time_with_constant_string: [ OK ] 0.89 sec. 2026-03-09 10:38:00 00929_multi_match_edit_distance: [ OK ] 2.50 sec. 2026-03-09 10:38:00 02124_insert_deduplication_token_replica: [ OK ] 0.89 sec. 2026-03-09 10:38:00 00678_shard_funnel_window: [ OK ] 1.09 sec. 2026-03-09 10:38:00 02502_analyzer_insert_select_crash_fix: [ OK ] 0.58 sec. 2026-03-09 10:38:01 01542_collate_in_array: [ OK ] 0.64 sec. 2026-03-09 10:38:01 01662_join_mixed: [ OK ] 0.52 sec. 2026-03-09 10:38:01 02883_array_scalar_mult_div_modulo: [ OK ] 0.73 sec. 2026-03-09 10:38:01 00120_join_and_group_by: [ OK ] 0.59 sec. 2026-03-09 10:38:01 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 0.64 sec. 2026-03-09 10:38:01 02915_analyzer_fuzz_5: [ OK ] 0.48 sec. 2026-03-09 10:38:01 02887_tuple_element_distributed: [ OK ] 0.47 sec. 2026-03-09 10:38:01 02833_sparse_columns_tuple_function: [ OK ] 0.53 sec. 2026-03-09 10:38:02 02124_buffer_with_type_map_long: [ OK ] 11.94 sec. 2026-03-09 10:38:02 03206_no_exceptions_clickhouse_local: [ FAIL ] 0.88 sec. 2026-03-09 10:38:02 Reason: return code: 134, result: 2026-03-09 10:38:02 2026-03-09 10:38:02 2026-03-09 10:38:02 2026-03-09 10:38:02 stdout: 2026-03-09 10:38:02 2026-03-09 10:38:02 2026-03-09 10:38:02 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 134942 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 10527007 --max_read_buffer_size 998128 --prefer_localhost_replica 0 --max_block_size 84091 --max_joined_block_size_rows 80546 --max_threads 2 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 47 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 39611754 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 1 --min_bytes_to_use_mmap_io 10516287620 --local_filesystem_read_method mmap --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 1 --compile_sort_description 1 --merge_tree_coarse_index_granularity 30 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 0 --max_bytes_before_external_group_by 10456063477 --max_bytes_before_remerge_sort 1477442778 --min_compress_block_size 53297 --max_compress_block_size 1065423 --merge_tree_compact_parts_min_granules_to_multibuffer_read 3 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 2999436 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 3 --session_timezone America/Hermosillo --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.52 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 100000000 --cross_join_min_bytes_to_compress 0 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 10 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 0 2026-03-09 10:38:02 2026-03-09 10:38:02 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.0 --prefer_fetch_merged_part_size_threshold 1 --vertical_merge_algorithm_min_rows_to_activate 334888 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 19858152 --index_granularity_bytes 7524378 --merge_max_block_size 3258 --index_granularity 2740 --min_bytes_for_wide_part 0 --marks_compress_block_size 74980 --primary_key_compress_block_size 93128 --replace_long_file_name_to_hash 1 --max_file_name_length 2 --min_bytes_for_full_part_storage 536870912 --compact_parts_max_bytes_to_buffer 297932604 --compact_parts_max_granules_to_buffer 123 --compact_parts_merge_max_bytes_to_prefetch_part 32832168 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 38 --old_parts_lifetime 480 2026-03-09 10:38:02 2026-03-09 10:38:02 Database: test_p43lk6tz 2026-03-09 10:38:02 01328_bad_peephole_optimization: [ OK ] 0.52 sec. 2026-03-09 10:38:02 01104_fixed_string_like: [ OK ] 0.77 sec. 2026-03-09 10:38:02 02932_parallel_replicas_fuzzer: [ OK ] 0.62 sec. 2026-03-09 10:38:02 00178_query_datetime64_index: [ OK ] 0.47 sec. 2026-03-09 10:38:02 00726_materialized_view_concurrent: [ OK ] 0.58 sec. 2026-03-09 10:38:02 01787_arena_assert_column_nothing: [ OK ] 0.43 sec. 2026-03-09 10:38:02 00009_array_join_subquery: [ OK ] 0.42 sec. 2026-03-09 10:38:03 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.47 sec. 2026-03-09 10:38:03 00065_shard_float_literals_formatting: [ OK ] 0.42 sec. 2026-03-09 10:38:03 02868_select_support_from_keywords: [ OK ] 0.38 sec. 2026-03-09 10:38:03 00453_top_k: [ OK ] 0.47 sec. 2026-03-09 10:38:03 02366_kql_create_table: [ OK ] 0.52 sec. 2026-03-09 10:38:04 01353_nullable_tuple: [ OK ] 1.08 sec. 2026-03-09 10:38:04 02429_combinators_in_array_reduce: [ OK ] 0.47 sec. 2026-03-09 10:38:04 01662_date_ubsan: [ OK ] 0.87 sec. 2026-03-09 10:38:04 01825_type_json_field: [ OK ] 0.63 sec. 2026-03-09 10:38:04 00688_low_cardinality_alter_add_column: [ OK ] 0.42 sec. 2026-03-09 10:38:05 01251_string_comparison: [ OK ] 0.57 sec. 2026-03-09 10:38:05 00936_crc_functions: [ OK ] 0.53 sec. 2026-03-09 10:38:06 02317_distinct_in_order_optimization_explain: [ OK ] 23.90 sec. 2026-03-09 10:38:07 02845_parquet_odd_decimals: [ OK ] 2.33 sec. 2026-03-09 10:38:07 01562_agg_null_for_empty_ahead: [ OK ] 0.62 sec. 2026-03-09 10:38:07 01091_insert_with_default_json: [ OK ] 0.52 sec. 2026-03-09 10:38:07 02699_polygons_sym_difference_total: [ OK ] 0.47 sec. 2026-03-09 10:38:07 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 9.31 sec. 2026-03-09 10:38:08 03134_positional_arguments: [ OK ] 2.88 sec. 2026-03-09 10:38:08 00360_to_date_from_string_with_datetime: [ OK ] 0.42 sec. 2026-03-09 10:38:08 01768_extended_range: [ OK ] 0.52 sec. 2026-03-09 10:38:08 02241_short_circuit_short_column: [ OK ] 0.47 sec. 2026-03-09 10:38:08 02998_primary_key_skip_columns: [ SKIPPED ] 0.00 sec. 2026-03-09 10:38:08 Reason: not running for current build 2026-03-09 10:38:08 01088_array_slice_of_aggregate_functions: [ OK ] 0.47 sec. 2026-03-09 10:38:09 02276_full_sort_join_unsupported: [ OK ] 0.62 sec. 2026-03-09 10:38:09 02332_dist_insert_send_logs_level: [ OK ] 1.47 sec. 2026-03-09 10:38:09 02457_filesystem_function: [ OK ] 0.47 sec. 2026-03-09 10:38:09 01050_engine_join_view_crash: [ OK ] 0.57 sec. 2026-03-09 10:38:09 01069_database_memory: [ OK ] 0.52 sec. 2026-03-09 10:38:09 02416_json_tuple_to_array_schema_inference: [ OK ] 0.42 sec. 2026-03-09 10:38:10 01825_type_json_1: [ OK ] 0.82 sec. 2026-03-09 10:38:10 02129_window_functions_disable_optimizations: [ OK ] 0.52 sec. 2026-03-09 10:38:10 02872_null_as_default_nested: [ OK ] 5.14 sec. 2026-03-09 10:38:10 02229_client_stop_multiquery_in_SIGINT: [ OK ] 7.35 sec. 2026-03-09 10:38:10 00609_prewhere_and_default: [ OK ] 1.22 sec. 2026-03-09 10:38:12 02718_cli_dashed_options_parsing: [ OK ] 2.93 sec. 2026-03-09 10:38:12 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 9.85 sec. 2026-03-09 10:38:12 00432_aggregate_function_scalars_and_constants: [ OK ] 0.62 sec. 2026-03-09 10:38:12 02097_initializeAggregationNullable: [ OK ] 0.42 sec. 2026-03-09 10:38:13 00695_pretty_max_column_pad_width: [ OK ] 0.42 sec. 2026-03-09 10:38:13 00004_shard_format_ast_and_remote_table: [ OK ] 0.42 sec. 2026-03-09 10:38:14 02581_share_big_sets_between_mutation_tasks: [ OK ] 12.92 sec. 2026-03-09 10:38:14 00753_quantile_format: [ OK ] 0.67 sec. 2026-03-09 10:38:14 01669_test_toYear_mysql_dialect: [ OK ] 0.42 sec. 2026-03-09 10:38:14 00837_minmax_index: [ OK ] 3.93 sec. 2026-03-09 10:38:15 02732_rename_after_processing: [ OK ] 4.33 sec. 2026-03-09 10:38:15 01655_window_functions_bug: [ OK ] 0.43 sec. 2026-03-09 10:38:15 02786_parquet_big_integer_compatibility: [ OK ] 1.12 sec. 2026-03-09 10:38:15 02006_test_positional_arguments_on_cluster: [ OK ] 0.93 sec. 2026-03-09 10:38:15 01511_different_expression_with_same_alias: [ OK ] 0.52 sec. 2026-03-09 10:38:15 02843_context_has_expired: [ OK ] 0.57 sec. 2026-03-09 10:38:16 01603_decimal_mult_float: [ OK ] 0.57 sec. 2026-03-09 10:38:16 00999_nullable_nested_types_4877: [ OK ] 0.62 sec. 2026-03-09 10:38:16 02306_rowbinary_has_no_bom: [ OK ] 0.92 sec. 2026-03-09 10:38:17 01268_mergine_sorted_limit: [ OK ] 0.52 sec. 2026-03-09 10:38:17 02521_analyzer_array_join_crash: [ OK ] 0.58 sec. 2026-03-09 10:38:17 03143_cte_scope: [ OK ] 0.47 sec. 2026-03-09 10:38:17 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.42 sec. 2026-03-09 10:38:17 01666_merge_tree_max_query_limit: [ OK ] 7.49 sec. 2026-03-09 10:38:18 01234_to_string_monotonic: [ OK ] 0.87 sec. 2026-03-09 10:38:18 02004_intersect_except_distinct_operators: [ OK ] 1.13 sec. 2026-03-09 10:38:18 02114_bool_type: [ OK ] 0.47 sec. 2026-03-09 10:38:18 03107_ill_formed_select_in_materialized_view: [ OK ] 0.47 sec. 2026-03-09 10:38:18 00033_fixed_string_to_string: [ OK ] 0.47 sec. 2026-03-09 10:38:19 00402_nan_and_extremes: [ OK ] 0.52 sec. 2026-03-09 10:38:19 02710_protobuf_ipv4_date32: [ OK ] 1.53 sec. 2026-03-09 10:38:19 00404_null_literal: [ OK ] 0.43 sec. 2026-03-09 10:38:19 00916_add_materialized_column_after: [ OK ] 0.42 sec. 2026-03-09 10:38:19 01894_jit_aggregation_function_max_long: [ OK ] 1.63 sec. 2026-03-09 10:38:20 02353_translate: [ OK ] 0.52 sec. 2026-03-09 10:38:20 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 7.15 sec. 2026-03-09 10:38:20 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.47 sec. 2026-03-09 10:38:20 01825_new_type_json_add_column: [ OK ] 0.78 sec. 2026-03-09 10:38:20 02911_cte_invalid_query_analysis: [ OK ] 0.57 sec. 2026-03-09 10:38:21 02477_s3_request_throttler: [ OK ] 2.38 sec. 2026-03-09 10:38:21 00738_nested_merge_multidimensional_array: [ OK ] 0.47 sec. 2026-03-09 10:38:21 03215_multilinestring_geometry: [ OK ] 0.52 sec. 2026-03-09 10:38:21 01620_fix_simple_state_arg_type: [ OK ] 0.52 sec. 2026-03-09 10:38:21 03032_scalars_create_as_select: [ OK ] 0.47 sec. 2026-03-09 10:38:21 01848_partition_value_column: [ OK ] 0.58 sec. 2026-03-09 10:38:21 01927_query_views_log_matview_exceptions: [ OK ] 6.70 sec. 2026-03-09 10:38:22 01670_distributed_bytes_to_throw_insert: [ OK ] 0.52 sec. 2026-03-09 10:38:22 03001_bad_error_message_higher_order_functions: [ OK ] 1.18 sec. 2026-03-09 10:38:22 02730_with_fill_by_sorting_prefix: [ OK ] 0.87 sec. 2026-03-09 10:38:22 01442_merge_detach_attach_long: [ SKIPPED ] 0.00 sec. 2026-03-09 10:38:22 Reason: not running for current build 2026-03-09 10:38:22 03205_system_sync_replica_format: [ OK ] 0.42 sec. 2026-03-09 10:38:23 02554_log_faminy_support_storage_policy: [ OK ] 0.63 sec. 2026-03-09 10:38:23 01825_new_type_json_insert_select: [ OK ] 0.82 sec. 2026-03-09 10:38:24 00825_protobuf_format_squares: [ OK ] 2.88 sec. 2026-03-09 10:38:24 03221_merge_profile_events: [ OK ] 1.43 sec. 2026-03-09 10:38:25 02811_insert_schema_inference: [ OK ] 0.47 sec. 2026-03-09 10:38:25 03015_optimize_final_rmt: [ OK ] 6.39 sec. 2026-03-09 10:38:26 01893_jit_aggregation_function_min_long: [ OK ] 1.38 sec. 2026-03-09 10:38:26 01942_untuple_transformers_msan: [ OK ] 0.42 sec. 2026-03-09 10:38:26 01307_orc_output_format: [ OK ] 3.69 sec. 2026-03-09 10:38:26 03098_prefer_column_to_alias_subquery: [ OK ] 0.62 sec. 2026-03-09 10:38:26 03037_dot_product_overflow: [ OK ] 0.42 sec. 2026-03-09 10:38:27 01559_aggregate_null_for_empty_fix: [ OK ] 0.57 sec. 2026-03-09 10:38:27 00429_point_in_ellipses: [ OK ] 0.42 sec. 2026-03-09 10:38:27 01043_dictionary_attribute_properties_values: [ OK ] 0.47 sec. 2026-03-09 10:38:27 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.57 sec. 2026-03-09 10:38:27 03087_analyzer_subquery_with_alias: [ OK ] 0.52 sec. 2026-03-09 10:38:28 02525_analyzer_function_in_crash_fix: [ OK ] 0.42 sec. 2026-03-09 10:38:28 03058_analyzer_ambiguous_columns: [ OK ] 0.57 sec. 2026-03-09 10:38:28 02371_create_temporary_table_as_with_columns_list: [ OK ] 0.43 sec. 2026-03-09 10:38:28 03145_asof_join_ddb_inequalities: [ OK ] 0.67 sec. 2026-03-09 10:38:29 02381_parseDateTime64BestEffortUS: [ OK ] 0.48 sec. 2026-03-09 10:38:29 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 4.13 sec. 2026-03-09 10:38:29 02341_global_join_cte: [ OK ] 0.63 sec. 2026-03-09 10:38:29 01940_point_in_polygon_ubsan: [ OK ] 0.47 sec. 2026-03-09 10:38:29 01087_index_set_ubsan: [ OK ] 0.52 sec. 2026-03-09 10:38:30 00394_new_nested_column_keeps_offsets: [ OK ] 0.52 sec. 2026-03-09 10:38:30 02711_trim_aliases: [ OK ] 0.42 sec. 2026-03-09 10:38:30 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.47 sec. 2026-03-09 10:38:30 02400_memory_accounting_on_error: [ OK ] 0.83 sec. 2026-03-09 10:38:30 02798_explain_settings_not_applied_bug: [ OK ] 0.52 sec. 2026-03-09 10:38:30 03039_dynamic_aggregating_merge_tree: [ OK ] 20.69 sec. 2026-03-09 10:38:31 01720_engine_file_empty_if_not_exists: [ OK ] 0.42 sec. 2026-03-09 10:38:31 01079_new_range_reader_segfault: [ OK ] 0.47 sec. 2026-03-09 10:38:31 02493_analyzer_table_functions_untuple: [ OK ] 0.57 sec. 2026-03-09 10:38:31 00477_parsing_data_types: [ OK ] 0.37 sec. 2026-03-09 10:38:32 02354_vector_search_bugs: [ OK ] 0.77 sec. 2026-03-09 10:38:32 01942_snowflakeIDToDateTime: [ OK ] 0.77 sec. 2026-03-09 10:38:32 02982_unambiguous_alter_commands: [ OK ] 0.52 sec. 2026-03-09 10:38:32 03251_unaligned_window_function_state: [ OK ] 0.42 sec. 2026-03-09 10:38:32 02151_client_option_echo: [ OK ] 2.13 sec. 2026-03-09 10:38:33 02513_broken_datetime64_init_on_mac: [ OK ] 0.42 sec. 2026-03-09 10:38:33 02151_replace_regexp_all_empty_match_alternative: [ OK ] 0.52 sec. 2026-03-09 10:38:33 01460_line_as_string_format: [ OK ] 10.25 sec. 2026-03-09 10:38:33 02731_nothing_deserialization: [ OK ] 0.52 sec. 2026-03-09 10:38:33 00060_date_lut: [ OK ] 0.44 sec. 2026-03-09 10:38:33 00943_mv_rename_without_inner_table: [ OK ] 0.53 sec. 2026-03-09 10:38:34 01921_test_progress_bar: [ OK ] 0.47 sec. 2026-03-09 10:38:34 02874_array_random_sample: [ OK ] 7.34 sec. 2026-03-09 10:38:34 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 2.93 sec. 2026-03-09 10:38:35 00014_select_from_table_with_nested: [ OK ] 0.57 sec. 2026-03-09 10:38:35 02817_structure_to_schema: [ OK ] 14.17 sec. 2026-03-09 10:38:35 00700_decimal_arithm: [ OK ] 2.18 sec. 2026-03-09 10:38:35 00697_in_subquery_shard: [ OK ] 0.82 sec. 2026-03-09 10:38:36 02900_clickhouse_local_drop_current_database: [ OK ] 0.97 sec. 2026-03-09 10:38:36 02177_issue_31009: [ SKIPPED ] 0.00 sec. 2026-03-09 10:38:36 Reason: not running for current build 2026-03-09 10:38:36 03147_asof_join_ddb_missing: [ OK ] 2.03 sec. 2026-03-09 10:38:36 01392_column_resolve: [ OK ] 0.52 sec. 2026-03-09 10:38:36 02841_not_ready_set_constraints: [ OK ] 0.57 sec. 2026-03-09 10:38:36 02407_array_element_from_map_wrong_type: [ OK ] 0.47 sec. 2026-03-09 10:38:37 02260_alter_compact_part_drop_nested_column: [ OK ] 0.67 sec. 2026-03-09 10:38:37 01497_extract_all_groups_empty_match: [ OK ] 0.42 sec. 2026-03-09 10:38:37 00880_decimal_in_key: [ OK ] 1.63 sec. 2026-03-09 10:38:37 00515_enhanced_time_zones: [ OK ] 1.13 sec. 2026-03-09 10:38:37 01326_build_id: [ OK ] 0.42 sec. 2026-03-09 10:38:38 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.47 sec. 2026-03-09 10:38:38 03161_lightweight_delete_projection: [ OK ] 0.57 sec. 2026-03-09 10:38:38 02975_intdiv_with_decimal: [ OK ] 0.73 sec. 2026-03-09 10:38:38 02974_backup_query_format_null: [ OK ] 2.43 sec. 2026-03-09 10:38:39 02387_parse_date_as_datetime: [ OK ] 0.57 sec. 2026-03-09 10:38:39 02539_vertical_merge_compact_parts: [ OK ] 0.97 sec. 2026-03-09 10:38:39 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 0.59 sec. 2026-03-09 10:38:40 00898_parsing_bad_diagnostic_message: [ OK ] 1.17 sec. 2026-03-09 10:38:41 01183_custom_separated_format_http: [ OK ] 2.93 sec. 2026-03-09 10:38:41 01107_join_right_table_totals: [ OK ] 0.72 sec. 2026-03-09 10:38:41 00534_functions_bad_arguments1: [ SKIPPED ] 0.00 sec. 2026-03-09 10:38:41 Reason: not running for current build 2026-03-09 10:38:41 01067_join_null: [ OK ] 0.42 sec. 2026-03-09 10:38:42 00952_basic_constraints: [ OK ] 6.79 sec. 2026-03-09 10:38:42 02841_parallel_replicas_summary: [ OK ] 2.28 sec. 2026-03-09 10:38:42 02869_http_headers_elapsed_ns: [ OK ] 0.82 sec. 2026-03-09 10:38:43 02477_analyzer_array_join_with_join: [ OK ] 0.97 sec. 2026-03-09 10:38:43 02465_limit_trivial_max_rows_to_read: [ OK ] 0.58 sec. 2026-03-09 10:38:43 01710_projection_with_nullable_keys: [ OK ] 0.37 sec. 2026-03-09 10:38:43 01532_tuple_with_name_type: [ OK ] 0.47 sec. 2026-03-09 10:38:43 01914_ubsan_quantile_timing: [ OK ] 0.42 sec. 2026-03-09 10:38:45 01477_lc_in_merge_join_left_key: [ OK ] 1.02 sec. 2026-03-09 10:38:45 02480_client_option_print_num_processed_rows: [ OK ] 3.13 sec. 2026-03-09 10:38:45 02532_send_logs_level_test: [ SKIPPED ] 0.00 sec. 2026-03-09 10:38:45 Reason: not running for current build 2026-03-09 10:38:45 01825_type_json_mutations: [ OK ] 0.62 sec. 2026-03-09 10:38:45 00127_group_by_concat: [ OK ] 0.42 sec. 2026-03-09 10:38:46 00560_float_leading_plus_in_exponent: [ OK ] 0.42 sec. 2026-03-09 10:38:46 02995_forget_partition: [ OK ] 13.57 sec. 2026-03-09 10:38:46 00444_join_use_nulls: [ OK ] 0.52 sec. 2026-03-09 10:38:46 02481_xxh3_hash_function: [ OK ] 0.52 sec. 2026-03-09 10:38:46 01772_to_start_of_hour_align: [ OK ] 0.52 sec. 2026-03-09 10:38:47 02751_protobuf_ipv6: [ OK ] 1.07 sec. 2026-03-09 10:38:47 02366_explain_query_tree: [ OK ] 0.62 sec. 2026-03-09 10:38:47 02267_empty_arrays_read_reverse: [ OK ] 0.87 sec. 2026-03-09 10:38:47 02885_create_distributed_table_without_as: [ OK ] 0.47 sec. 2026-03-09 10:38:48 00621_regression_for_in_operator: [ OK ] 0.62 sec. 2026-03-09 10:38:49 03198_settings_in_csv_tsv_schema_cache: [ OK ] 1.63 sec. 2026-03-09 10:38:49 00940_order_by_read_in_order: [ OK ] 0.97 sec. 2026-03-09 10:38:49 01088_benchmark_query_id: [ OK ] 2.23 sec. 2026-03-09 10:38:49 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 5.94 sec. 2026-03-09 10:38:49 00564_temporary_table_management: [ OK ] 0.37 sec. 2026-03-09 10:38:50 01300_svg: [ OK ] 0.78 sec. 2026-03-09 10:38:50 02370_analyzer_in_function: [ OK ] 0.72 sec. 2026-03-09 10:38:50 01010_partial_merge_join_const_and_lc: [ OK ] 0.62 sec. 2026-03-09 10:38:51 00737_decimal_group_by: [ OK ] 0.52 sec. 2026-03-09 10:38:51 00111_shard_external_sort_distributed: [ OK ] 12.61 sec. 2026-03-09 10:38:51 01051_aggregate_function_crash: [ OK ] 0.42 sec. 2026-03-09 10:38:52 02165_h3_edge_length_km: [ OK ] 0.58 sec. 2026-03-09 10:38:52 02875_merge_engine_set_index: [ OK ] 2.38 sec. 2026-03-09 10:38:52 02991_count_rewrite_analyzer: [ OK ] 0.52 sec. 2026-03-09 10:38:53 01528_setting_aggregate_functions_null_for_empty: [ OK ] 0.78 sec. 2026-03-09 10:38:53 00732_decimal_summing_merge_tree: [ OK ] 0.52 sec. 2026-03-09 10:38:53 00066_group_by_in: [ OK ] 0.53 sec. 2026-03-09 10:38:54 01521_format_readable_time_delta2: [ OK ] 0.57 sec. 2026-03-09 10:38:55 02596_build_set_and_remote: [ OK ] 0.87 sec. 2026-03-09 10:38:55 02504_regexp_dictionary_ua_parser: [ OK ] 4.39 sec. 2026-03-09 10:38:55 02911_analyzer_explain_estimate: [ OK ] 0.47 sec. 2026-03-09 10:38:55 02995_index_9: [ SKIPPED ] 0.00 sec. 2026-03-09 10:38:55 Reason: not running for current build 2026-03-09 10:38:56 01440_big_int_exotic_casts: [ OK ] 0.87 sec. 2026-03-09 10:38:56 00472_create_view_if_not_exists: [ OK ] 0.42 sec. 2026-03-09 10:38:56 02812_pointwise_array_operations: [ OK ] 0.73 sec. 2026-03-09 10:38:57 01515_logtrace_function: [ OK ] 1.22 sec. 2026-03-09 10:38:57 01480_binary_operator_monotonicity: [ OK ] 0.87 sec. 2026-03-09 10:38:58 02354_vector_search_queries: [ OK ] 0.62 sec. 2026-03-09 10:38:58 02408_to_fixed_string_short_circuit: [ OK ] 0.48 sec. 2026-03-09 10:38:58 01077_mutations_index_consistency: [ OK ] 5.09 sec. 2026-03-09 10:38:58 01374_if_nullable_filimonov: [ OK ] 0.47 sec. 2026-03-09 10:38:58 01664_decimal_ubsan: [ OK ] 0.42 sec. 2026-03-09 10:38:58 03064_analyzer_named_subqueries: [ OK ] 0.42 sec. 2026-03-09 10:38:59 02149_schema_inference_create_table_syntax: [ OK ] 8.05 sec. 2026-03-09 10:38:59 01301_polygons_within: [ OK ] 0.57 sec. 2026-03-09 10:38:59 01034_JSONCompactEachRow: [ OK ] 1.03 sec. 2026-03-09 10:38:59 02016_aggregation_spark_bar: [ OK ] 1.17 sec. 2026-03-09 10:38:59 00181_aggregate_functions_statistics_stable: [ OK ] 0.82 sec. 2026-03-09 10:39:00 01825_type_json_ghdata_insert_select: [ OK ] 10.81 sec. 2026-03-09 10:39:00 02902_select_subcolumns_from_engine_null: [ OK ] 0.47 sec. 2026-03-09 10:39:00 01115_join_with_dictionary: [ OK ] 1.18 sec. 2026-03-09 10:39:00 03144_fuzz_quoted_type_name: [ OK ] 0.48 sec. 2026-03-09 10:39:00 02677_analyzer_compound_expressions: [ OK ] 0.72 sec. 2026-03-09 10:39:01 02354_with_statement_non_exist_column: [ OK ] 0.48 sec. 2026-03-09 10:39:01 01544_file_engine_settings: [ OK ] 1.28 sec. 2026-03-09 10:39:01 01837_cast_to_array_from_empty_array: [ OK ] 0.47 sec. 2026-03-09 10:39:01 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 0.72 sec. 2026-03-09 10:39:01 01825_type_json_missed_values: [ OK ] 0.57 sec. 2026-03-09 10:39:01 01508_explain_header: [ OK ] 0.43 sec. 2026-03-09 10:39:01 02676_kafka_murmur_hash: [ OK ] 0.47 sec. 2026-03-09 10:39:01 01144_multiword_data_types: [ OK ] 0.42 sec. 2026-03-09 10:39:01 02566_analyzer_limit_settings_distributed: [ OK ] 0.62 sec. 2026-03-09 10:39:01 00002_system_numbers: [ OK ] 0.47 sec. 2026-03-09 10:39:01 01225_drop_dictionary_as_table: [ OK ] 0.48 sec. 2026-03-09 10:39:02 03217_datetime64_constant_to_ast: [ OK ] 0.42 sec. 2026-03-09 10:39:02 01773_datetime64_add_ubsan: [ OK ] 0.42 sec. 2026-03-09 10:39:02 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 0.68 sec. 2026-03-09 10:39:02 02244_ip_address_invalid_insert: [ OK ] 0.88 sec. 2026-03-09 10:39:03 01605_key_condition_enum_int: [ OK ] 0.47 sec. 2026-03-09 10:39:03 00229_prewhere_column_missing: [ OK ] 0.62 sec. 2026-03-09 10:39:03 01073_crlf_end_of_line: [ OK ] 0.57 sec. 2026-03-09 10:39:03 02012_zookeeper_changed_enum_type: [ OK ] 0.57 sec. 2026-03-09 10:39:03 02491_part_log_has_table_uuid: [ OK ] 0.88 sec. 2026-03-09 10:39:04 01499_json_named_tuples: [ OK ] 0.47 sec. 2026-03-09 10:39:04 01605_drop_settings_profile_while_assigned: [ OK ] 0.57 sec. 2026-03-09 10:39:04 01395_limit_more_cases: [ OK ] 30.48 sec. 2026-03-09 10:39:04 01607_arrays_as_nested_csv: [ OK ] 2.84 sec. 2026-03-09 10:39:04 01119_optimize_trivial_insert_select: [ OK ] 0.92 sec. 2026-03-09 10:39:04 00473_output_format_json_quote_denormals: [ OK ] 3.23 sec. 2026-03-09 10:39:05 01136_multiple_sets: [ OK ] 0.53 sec. 2026-03-09 10:39:05 01283_max_threads_simple_query_optimization: [ OK ] 0.93 sec. 2026-03-09 10:39:05 00082_append_trailing_char_if_absent: [ OK ] 0.47 sec. 2026-03-09 10:39:05 01379_with_fill_several_columns: [ OK ] 0.42 sec. 2026-03-09 10:39:05 00278_insert_already_sorted: [ OK ] 0.83 sec. 2026-03-09 10:39:05 02864_profile_event_part_lock: [ OK ] 0.47 sec. 2026-03-09 10:39:05 01547_query_log_current_database: [ OK ] 0.88 sec. 2026-03-09 10:39:05 03290_limit_by_segv: [ OK ] 0.48 sec. 2026-03-09 10:39:05 02364_window_case: [ OK ] 0.47 sec. 2026-03-09 10:39:06 01074_h3_range_check: [ OK ] 0.57 sec. 2026-03-09 10:39:06 02456_alter-nullable-column-bag-2: [ OK ] 0.57 sec. 2026-03-09 10:39:06 01123_parse_date_time_best_effort_even_more: [ OK ] 0.42 sec. 2026-03-09 10:39:06 02680_illegal_type_of_filter_projection: [ OK ] 0.52 sec. 2026-03-09 10:39:06 01910_view_dictionary_check_refresh: [ OK ] 24.66 sec. 2026-03-09 10:39:06 01710_projection_group_by_order_by: [ OK ] 0.32 sec. 2026-03-09 10:39:06 00753_distributed_system_columns_and_system_tables: [ OK ] 0.53 sec. 2026-03-09 10:39:06 02971_limit_by_distributed: [ OK ] 0.57 sec. 2026-03-09 10:39:07 03014_window_view_crash: [ OK ] 0.47 sec. 2026-03-09 10:39:07 00556_array_intersect: [ OK ] 0.58 sec. 2026-03-09 10:39:07 00725_memory_tracking: [ OK ] 1.12 sec. 2026-03-09 10:39:07 01554_interpreter_integer_float: [ OK ] 0.47 sec. 2026-03-09 10:39:07 00113_shard_group_array: [ OK ] 3.33 sec. 2026-03-09 10:39:08 00961_check_table: [ OK ] 0.62 sec. 2026-03-09 10:39:08 02049_clickhouse_local_merge_tree: [ OK ] 1.17 sec. 2026-03-09 10:39:08 00268_aliases_without_as_keyword: [ OK ] 0.42 sec. 2026-03-09 10:39:08 00240_replace_substring_loop: [ OK ] 1.27 sec. 2026-03-09 10:39:08 00936_substring_utf8_non_const: [ OK ] 2.03 sec. 2026-03-09 10:39:09 01600_multiple_left_join_with_aliases: [ OK ] 0.52 sec. 2026-03-09 10:39:09 02151_lc_prefetch: [ SKIPPED ] 0.00 sec. 2026-03-09 10:39:09 Reason: not running for current build 2026-03-09 10:39:09 02771_jit_functions_comparison_crash: [ OK ] 0.52 sec. 2026-03-09 10:39:09 00981_no_virtual_columns: [ OK ] 0.53 sec. 2026-03-09 10:39:09 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 0.42 sec. 2026-03-09 10:39:09 00712_prewhere_with_alias_bug: [ OK ] 0.47 sec. 2026-03-09 10:39:10 02009_body_query_params: [ OK ] 0.87 sec. 2026-03-09 10:39:10 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 0.62 sec. 2026-03-09 10:39:10 03085_analyzer_alias_column_group_by: [ OK ] 0.47 sec. 2026-03-09 10:39:10 00159_whitespace_in_columns_list: [ OK ] 0.47 sec. 2026-03-09 10:39:11 01045_bloom_filter_null_array: [ OK ] 0.58 sec. 2026-03-09 10:39:12 00974_primary_key_for_lowCardinality: [ OK ] 3.93 sec. 2026-03-09 10:39:12 01076_json_each_row_array: [ OK ] 1.28 sec. 2026-03-09 10:39:12 01381_for_each_with_states: [ OK ] 0.52 sec. 2026-03-09 10:39:13 02366_normalize_aggregate_function_types_and_states: [ OK ] 0.42 sec. 2026-03-09 10:39:13 01086_window_view_cleanup: [ OK ] 6.99 sec. 2026-03-09 10:39:13 03006_mv_deduplication_throw_if_async_insert: [ OK ] 0.77 sec. 2026-03-09 10:39:14 02135_local_create_db: [ OK ] 1.17 sec. 2026-03-09 10:39:14 01475_read_subcolumns_3: [ OK ] 0.68 sec. 2026-03-09 10:39:15 00558_parse_floats: [ OK ] 0.47 sec. 2026-03-09 10:39:15 02999_ulid_short_circuit: [ OK ] 0.42 sec. 2026-03-09 10:39:15 03036_parquet_arrow_nullable: [ OK ] 8.10 sec. 2026-03-09 10:39:16 02915_sleep_large_uint: [ OK ] 0.47 sec. 2026-03-09 10:39:16 00696_system_columns_limit: [ OK ] 0.58 sec. 2026-03-09 10:39:16 02864_statistics_predicates: [ OK ] 2.08 sec. 2026-03-09 10:39:16 00488_column_name_primary: [ OK ] 0.47 sec. 2026-03-09 10:39:17 03166_mv_prewhere_duplicating_name_bug: [ OK ] 0.52 sec. 2026-03-09 10:39:17 02814_create_index_uniq_noop: [ OK ] 0.43 sec. 2026-03-09 10:39:17 02813_seriesOutliersDetectTukey: [ OK ] 0.68 sec. 2026-03-09 10:39:18 02374_analyzer_join_using: [ OK ] 2.14 sec. 2026-03-09 10:39:18 01470_columns_transformers2: [ OK ] 0.52 sec. 2026-03-09 10:39:18 02902_add_scalar_in_all_case: [ OK ] 0.47 sec. 2026-03-09 10:39:18 02015_async_inserts_2: [ OK ] 1.42 sec. 2026-03-09 10:39:18 01259_datetime64_ubsan: [ OK ] 0.52 sec. 2026-03-09 10:39:19 01710_normal_projections: [ OK ] 9.05 sec. 2026-03-09 10:39:19 03120_analyzer_param_in_CTE_alias: [ OK ] 0.42 sec. 2026-03-09 10:39:19 00353_join_by_tuple: [ OK ] 0.42 sec. 2026-03-09 10:39:19 02366_kql_func_math: [ OK ] 0.53 sec. 2026-03-09 10:39:19 00980_zookeeper_merge_tree_alter_settings: [ OK ] 0.98 sec. 2026-03-09 10:39:19 00217_shard_global_subquery_columns_with_same_name: [ OK ] 0.49 sec. 2026-03-09 10:39:19 02097_polygon_dictionary_store_key: [ OK ] 0.52 sec. 2026-03-09 10:39:20 03121_analyzer_filed_redefenition_in_subquery: [ OK ] 0.42 sec. 2026-03-09 10:39:20 02304_grouping_set_order_by: [ OK ] 0.42 sec. 2026-03-09 10:39:20 03043_group_array_result_is_expected: [ OK ] 0.47 sec. 2026-03-09 10:39:20 01917_prewhere_column_type: [ OK ] 0.57 sec. 2026-03-09 10:39:20 01409_topK_merge: [ OK ] 0.62 sec. 2026-03-09 10:39:21 01786_group_by_pk_many_streams: [ OK ] 0.72 sec. 2026-03-09 10:39:21 00937_ipv4_cidr_range: [ OK ] 0.57 sec. 2026-03-09 10:39:21 01017_uniqCombined_memory_usage: [ OK ] 1.12 sec. 2026-03-09 10:39:21 00109_shard_totals_after_having: [ OK ] 1.23 sec. 2026-03-09 10:39:21 02910_bad_logs_level_in_local: [ OK ] 0.27 sec. 2026-03-09 10:39:21 01255_geo_types_livace: [ OK ] 0.47 sec. 2026-03-09 10:39:22 00805_round_down: [ OK ] 0.67 sec. 2026-03-09 10:39:22 02157_readonly_system_suspend: [ OK ] 1.07 sec. 2026-03-09 10:39:22 01622_constraints_where_optimization: [ OK ] 0.57 sec. 2026-03-09 10:39:22 00836_indices_alter_replicated_zookeeper_long: [ OK ] 1.22 sec. 2026-03-09 10:39:22 01020_having_without_group_by: [ OK ] 0.42 sec. 2026-03-09 10:39:22 00800_versatile_storage_join: [ OK ] 0.72 sec. 2026-03-09 10:39:23 03273_dynamic_pretty_json_serialization: [ OK ] 0.47 sec. 2026-03-09 10:39:23 03217_filtering_in_storage_merge: [ OK ] 0.52 sec. 2026-03-09 10:39:23 02910_replicated_merge_parameters_must_consistent: [ OK ] 0.98 sec. 2026-03-09 10:39:23 01576_alias_column_rewrite: [ OK ] 1.18 sec. 2026-03-09 10:39:23 01666_date_lut_buffer_overflow: [ OK ] 0.43 sec. 2026-03-09 10:39:23 02167_format_from_file_extension: [ OK ] 17.98 sec. 2026-03-09 10:39:24 02383_schema_inference_hints: [ OK ] 0.52 sec. 2026-03-09 10:39:24 03161_cnf_reduction: [ OK ] 0.67 sec. 2026-03-09 10:39:24 01403_datetime64_constant_arg: [ OK ] 0.42 sec. 2026-03-09 10:39:24 02292_nested_not_flattened_detach: [ OK ] 0.37 sec. 2026-03-09 10:39:24 00972_geohashesInBox: [ OK ] 0.97 sec. 2026-03-09 10:39:24 03041_dynamic_type_check_table: [ OK ] 12.06 sec. 2026-03-09 10:39:25 00674_join_on_syntax: [ OK ] 1.17 sec. 2026-03-09 10:39:25 01343_min_bytes_to_use_mmap_io: [ OK ] 0.87 sec. 2026-03-09 10:39:26 00260_like_and_curly_braces: [ OK ] 0.67 sec. 2026-03-09 10:39:26 01852_hints_enum_name: [ OK ] 1.07 sec. 2026-03-09 10:39:26 02177_merge_optimize_aggregation_in_order: [ OK ] 0.52 sec. 2026-03-09 10:39:26 02815_range_dict_no_direct_join: [ OK ] 0.52 sec. 2026-03-09 10:39:27 02382_analyzer_matcher_join_using: [ OK ] 0.87 sec. 2026-03-09 10:39:27 02141_clickhouse_local_interactive_table: [ OK ] 1.12 sec. 2026-03-09 10:39:27 03040_recursive_cte_postgres_6: [ OK ] 0.92 sec. 2026-03-09 10:39:27 02518_delete_on_materialized_view: [ OK ] 0.52 sec. 2026-03-09 10:39:28 02385_analyzer_aliases_compound_expression: [ OK ] 0.52 sec. 2026-03-09 10:39:28 02021_h3_is_res_classIII: [ OK ] 0.47 sec. 2026-03-09 10:39:28 02039_group_by_with_totals_having: [ OK ] 0.50 sec. 2026-03-09 10:39:28 02955_analyzer_using_functional_args: [ OK ] 1.48 sec. 2026-03-09 10:39:28 02311_create_table_with_unknown_format: [ OK ] 0.57 sec. 2026-03-09 10:39:29 01307_polygon_perimeter: [ OK ] 0.42 sec. 2026-03-09 10:39:29 01471_top_k_range_check: [ OK ] 0.52 sec. 2026-03-09 10:39:29 02353_isnullable: [ OK ] 0.52 sec. 2026-03-09 10:39:29 01614_with_fill_with_limit: [ OK ] 0.47 sec. 2026-03-09 10:39:29 02789_jit_cannot_convert_column: [ OK ] 0.47 sec. 2026-03-09 10:39:29 00953_constraints_operations: [ OK ] 5.54 sec. 2026-03-09 10:39:30 00613_shard_distributed_max_execution_time: [ OK ] 0.52 sec. 2026-03-09 10:39:30 01871_merge_tree_compile_expressions: [ OK ] 1.07 sec. 2026-03-09 10:39:30 01646_fix_window_funnel_inconistency: [ OK ] 0.58 sec. 2026-03-09 10:39:30 02242_case_insensitive_column_matching: [ OK ] 6.49 sec. 2026-03-09 10:39:30 02343_group_by_use_nulls: [ OK ] 0.58 sec. 2026-03-09 10:39:31 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 0.82 sec. 2026-03-09 10:39:31 03161_decimal_binary_math: [ OK ] 1.18 sec. 2026-03-09 10:39:31 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 0.67 sec. 2026-03-09 10:39:31 00045_sorting_by_fixed_string_descending: [ OK ] 0.42 sec. 2026-03-09 10:39:31 00589_removal_unused_columns_aggregation: [ OK ] 0.57 sec. 2026-03-09 10:39:31 02476_analyzer_identifier_hints: [ OK ] 20.80 sec. 2026-03-09 10:39:31 02311_range_hashed_dictionary_range_cast: [ OK ] 0.52 sec. 2026-03-09 10:39:31 01049_join_low_card_bug_long: [ OK ] 7.24 sec. 2026-03-09 10:39:32 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.47 sec. 2026-03-09 10:39:32 2026-03-09 10:39:32 388 tests passed. 8 tests skipped. 809.34 s elapsed (Process-10). 2026-03-09 10:39:32 03032_rmt_create_columns_from_replica: [ OK ] 0.52 sec. 2026-03-09 10:39:32 2026-03-09 10:39:32 512 tests passed. 3 tests skipped. 809.38 s elapsed (Process-3). 2026-03-09 10:39:32 01125_dict_ddl_cannot_add_column: [ OK ] 0.47 sec. 2026-03-09 10:39:32 2026-03-09 10:39:32 Having 1 errors! 346 tests passed. 5 tests skipped. 809.38 s elapsed (Process-4). 2026-03-09 10:39:32 02969_analyzer_eliminate_injective_functions: [ OK ] 0.57 sec. 2026-03-09 10:39:32 2026-03-09 10:39:32 Having 1 errors! 388 tests passed. 4 tests skipped. 809.39 s elapsed (Process-5). 2026-03-09 10:39:32 01013_hex_decimal: [ OK ] 0.47 sec. 2026-03-09 10:39:32 2026-03-09 10:39:32 442 tests passed. 3 tests skipped. 809.42 s elapsed (Process-6). 2026-03-09 10:39:34 03680_loop_table_function_access_check: [ OK ] 2.73 sec. 2026-03-09 10:39:34 2026-03-09 10:39:34 464 tests passed. 8 tests skipped. 811.65 s elapsed (Process-8). 2026-03-09 10:39:34 00945_bloom_filter_index: [ OK ] 4.49 sec. 2026-03-09 10:39:34 2026-03-09 10:39:34 386 tests passed. 6 tests skipped. 812.09 s elapsed (Process-9). 2026-03-09 10:39:37 02481_async_insert_dedup: [ OK ] 86.91 sec. 2026-03-09 10:39:37 2026-03-09 10:39:37 284 tests passed. 4 tests skipped. 814.32 s elapsed (Process-7). 2026-03-09 10:39:44 Running 281 stateless tests (MainProcess). 2026-03-09 10:39:50 03231_restore_user_with_existing_role: [ OK ] 6.00 sec. 2026-03-09 10:39:55 03206_replication_lag_metric: [ OK ] 5.64 sec. 2026-03-09 10:39:56 03198_table_function_directory_path: [ OK ] 0.62 sec. 2026-03-09 10:39:56 03198_dynamic_read_subcolumns: [ OK ] 0.42 sec. 2026-03-09 10:39:57 03168_loop_engine_with_parallel_replicas: [ OK ] 0.47 sec. 2026-03-09 10:39:59 03154_lazy_token_iterator: [ OK ] 2.33 sec. 2026-03-09 10:40:19 03151_unload_index_race: [ OK ] 20.01 sec. 2026-03-09 10:40:19 03147_system_columns_access_checks: [ SKIPPED ] 0.00 sec. 2026-03-09 10:40:19 Reason: not running for current build 2026-03-09 10:40:20 03147_parquet_memory_tracking: [ OK ] 1.08 sec. 2026-03-09 10:40:21 03147_table_function_loop: [ OK ] 0.58 sec. 2026-03-09 10:41:41 03008_deduplication_mv_generates_several_blocks_replicated: [ OK ] 80.28 sec. 2026-03-09 10:41:48 03008_s3_plain_rewritable_fault: [ OK ] 6.40 sec. 2026-03-09 10:42:48 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 59.75 sec. 2026-03-09 10:43:48 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 60.36 sec. 2026-03-09 10:45:07 03008_deduplication_insert_several_blocks_replicated: [ OK ] 78.53 sec. 2026-03-09 10:45:10 03002_part_log_rmt_fetch_merge_error: [ OK ] 3.59 sec. 2026-03-09 10:45:15 03002_part_log_rmt_fetch_mutate_error: [ OK ] 5.24 sec. 2026-03-09 10:45:16 02990_rmt_replica_path_uuid: [ OK ] 0.62 sec. 2026-03-09 10:45:20 02980_dist_insert_readonly_replica: [ OK ] 4.34 sec. 2026-03-09 10:45:24 02973_backup_of_in_memory_compressed: [ OK ] 3.19 sec. 2026-03-09 10:46:13 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 49.06 sec. 2026-03-09 10:46:14 02961_drop_tables: [ OK ] 0.78 sec. 2026-03-09 10:46:14 02960_partition_by_udf: [ OK ] 0.63 sec. 2026-03-09 10:46:20 02944_dynamically_change_filesystem_cache_size: [ OK ] 5.44 sec. 2026-03-09 10:46:26 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 5.74 sec. 2026-03-09 10:46:26 02931_max_num_to_warn: [ OK ] 0.73 sec. 2026-03-09 10:46:31 02916_move_partition_inactive_replica: [ OK ] 4.34 sec. 2026-03-09 10:46:34 02915_move_partition_inactive_replica: [ OK ] 3.69 sec. 2026-03-09 10:46:35 02911_row_policy_on_cluster: [ OK ] 0.82 sec. 2026-03-09 10:46:36 02910_prefetch_unexpceted_exception: [ OK ] 0.38 sec. 2026-03-09 10:46:36 02908_empty_named_collection: [ OK ] 0.47 sec. 2026-03-09 10:46:42 02908_many_requests_to_system_replicas: [ OK ] 4.95 sec. 2026-03-09 10:46:48 02888_replicated_merge_tree_creation: [ OK ] 5.75 sec. 2026-03-09 10:46:48 02887_insert_quorum_wo_keeper_retries: [ OK ] 0.73 sec. 2026-03-09 10:46:49 02884_async_insert_skip_settings: [ OK ] 1.03 sec. 2026-03-09 10:46:53 02884_async_insert_native_protocol_3: [ OK ] 3.69 sec. 2026-03-09 10:47:04 02874_parquet_multiple_batches_array_inconsistent_offsets: [ OK ] 11.37 sec. 2026-03-09 10:47:19 02871_peak_threads_usage: [ OK ] 14.27 sec. 2026-03-09 10:47:19 02867_create_user_ssh: [ OK ] 0.47 sec. 2026-03-09 10:47:20 02863_delayed_source_with_totals_and_extremes: [ OK ] 0.73 sec. 2026-03-09 10:47:23 02845_threads_count_in_distributed_queries: [ OK ] 3.24 sec. 2026-03-09 10:47:24 02843_insertion_table_schema_infer: [ OK ] 1.03 sec. 2026-03-09 10:47:28 02841_parquet_filter_pushdown: [ OK ] 3.99 sec. 2026-03-09 10:47:29 02833_multiprewhere_extra_column: [ OK ] 0.63 sec. 2026-03-09 10:47:33 02808_filesystem_cache_drop_query: [ OK ] 3.89 sec. 2026-03-09 10:47:35 02796_calculate_text_stack_trace: [ OK ] 1.78 sec. 2026-03-09 10:47:39 02789_filesystem_cache_alignment: [ OK ] 4.59 sec. 2026-03-09 10:47:42 02789_table_functions_errors: [ OK ] 2.13 sec. 2026-03-09 10:47:42 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec. 2026-03-09 10:47:42 Reason: not running for current build 2026-03-09 10:47:43 02775_show_columns_called_from_mysql: [ OK ] 1.08 sec. 2026-03-09 10:47:43 02762_replicated_database_no_args: [ OK ] 0.42 sec. 2026-03-09 10:47:45 02751_ip_types_aggregate_functions_states: [ OK ] 1.28 sec. 2026-03-09 10:47:47 02736_reading_and_writing_structure_fields: [ OK ] 1.98 sec. 2026-03-09 10:47:48 02735_capnp_case_insensitive_names_matching: [ OK ] 1.07 sec. 2026-03-09 10:47:55 02735_parquet_encoder: [ OK ] 7.20 sec. 2026-03-09 10:47:56 02725_url_support_virtual_column: [ OK ] 0.63 sec. 2026-03-09 10:48:25 02725_start_stop_fetches: [ OK ] 29.14 sec. 2026-03-09 10:48:25 02710_default_replicated_parameters: [ OK ] 0.47 sec. 2026-03-09 10:48:26 02706_show_columns: [ OK ] 0.93 sec. 2026-03-09 10:48:43 02700_s3_part_INT_MAX: [ OK ] 16.84 sec. 2026-03-09 10:48:43 02581_share_big_sets_between_mutation_tasks_long: [ SKIPPED ] 0.00 sec. 2026-03-09 10:48:43 Reason: not running for current build 2026-03-09 10:48:44 02572_system_logs_materialized_views_ignore_errors: [ OK ] 1.18 sec. 2026-03-09 10:48:48 02566_ipv4_ipv6_binary_formats: [ OK ] 3.99 sec. 2026-03-09 10:48:49 02561_temporary_table_sessions: [ OK ] 1.03 sec. 2026-03-09 10:48:51 02541_arrow_duration_type: [ OK ] 1.23 sec. 2026-03-09 10:49:15 02535_max_parallel_replicas_custom_key_mt: [ OK ] 24.57 sec. 2026-03-09 10:49:41 02535_max_parallel_replicas_custom_key_rmt: [ OK ] 25.22 sec. 2026-03-09 10:49:42 02522_avro_complicate_schema: [ OK ] 1.28 sec. 2026-03-09 10:50:23 02515_cleanup_async_insert_block_ids: [ OK ] 41.03 sec. 2026-03-09 10:50:24 02510_orc_map_indexes: [ OK ] 1.04 sec. 2026-03-09 10:50:26 02503_cache_on_write_with_small_segment_size: [ OK ] 1.78 sec. 2026-03-09 10:50:30 02503_insert_storage_snapshot: [ OK ] 3.99 sec. 2026-03-09 10:50:31 02501_deep_recusion_schema_inference: [ OK ] 1.48 sec. 2026-03-09 10:50:31 02497_trace_events_stress_long: [ SKIPPED ] 0.00 sec. 2026-03-09 10:50:31 Reason: not running for current build 2026-03-09 10:50:32 02495_s3_filter_by_file: [ OK ] 0.72 sec. 2026-03-09 10:50:33 02494_query_cache_user_quotas_after_drop: [ OK ] 0.53 sec. 2026-03-09 10:50:33 02494_query_cache_query_log: [ OK ] 0.82 sec. 2026-03-09 10:50:34 02494_query_cache_case_agnostic_matching: [ OK ] 0.88 sec. 2026-03-09 10:50:35 02494_query_cache_compression: [ OK ] 0.63 sec. 2026-03-09 10:50:36 02494_query_cache_totals_extremes: [ OK ] 0.62 sec. 2026-03-09 10:50:36 02494_query_cache_exception_handling: [ OK ] 0.47 sec. 2026-03-09 10:50:37 02494_query_cache_eligible_queries: [ OK ] 0.68 sec. 2026-03-09 10:50:43 02494_query_cache_ttl_long: [ OK ] 6.60 sec. 2026-03-09 10:50:44 02494_query_cache_events: [ OK ] 0.83 sec. 2026-03-09 10:50:48 02494_trace_log_profile_events: [ OK ] 4.09 sec. 2026-03-09 10:50:49 02494_query_cache_bugs: [ OK ] 0.53 sec. 2026-03-09 10:50:50 02494_query_cache_squash_partial_results: [ OK ] 0.68 sec. 2026-03-09 10:50:50 02484_substitute_udf_storage_args: [ OK ] 0.47 sec. 2026-03-09 10:50:51 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 0.47 sec. 2026-03-09 10:50:53 02483_capnp_decimals: [ OK ] 2.13 sec. 2026-03-09 10:50:54 02482_new_json_nested_arrays_with_same_keys: [ OK ] 1.13 sec. 2026-03-09 10:50:55 02482_json_nested_arrays_with_same_keys: [ OK ] 1.18 sec. 2026-03-09 10:50:57 02481_custom_separated_and_template_with_csv_field: [ OK ] 1.68 sec. 2026-03-09 10:50:59 02459_glob_for_recursive_directory_traversal: [ OK ] 2.58 sec. 2026-03-09 10:51:00 02458_hdfs_cluster_schema_inference: [ OK ] 0.73 sec. 2026-03-09 10:51:04 02440_mutations_finalization: [ OK ] 3.64 sec. 2026-03-09 10:51:05 02422_msgpack_uuid_wrong_column: [ OK ] 0.52 sec. 2026-03-09 10:51:08 02422_allow_implicit_no_password: [ OK ] 3.03 sec. 2026-03-09 10:51:15 02421_record_errors_row_by_input_format: [ OK ] 7.71 sec. 2026-03-09 10:51:16 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.53 sec. 2026-03-09 10:51:17 02404_schema_inference_cache_respect_format_settings: [ OK ] 1.08 sec. 2026-03-09 10:51:17 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec. 2026-03-09 10:51:17 Reason: disabled 2026-03-09 10:51:17 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec. 2026-03-09 10:51:17 Reason: disabled 2026-03-09 10:51:18 02391_recursive_buffer: [ OK ] 0.62 sec. 2026-03-09 10:51:18 02385_profile_events_overflow: [ OK ] 0.62 sec. 2026-03-09 10:51:19 02376_arrow_dict_with_string: [ OK ] 0.47 sec. 2026-03-09 10:51:20 02373_heap_buffer_overflow_in_avro: [ OK ] 1.43 sec. 2026-03-09 10:51:20 02352_rwlock: [ SKIPPED ] 0.00 sec. 2026-03-09 10:51:20 Reason: not running for current build 2026-03-09 10:51:21 02350_views_max_insert_threads: [ OK ] 0.98 sec. 2026-03-09 10:51:22 02346_additional_filters_distr: [ OK ] 0.63 sec. 2026-03-09 10:51:25 02337_drop_filesystem_cache_access: [ OK ] 2.58 sec. 2026-03-09 10:51:25 02323_null_modifier_in_table_function: [ OK ] 0.48 sec. 2026-03-09 10:51:26 02313_avro_records_and_maps: [ OK ] 0.63 sec. 2026-03-09 10:51:27 02311_system_zookeeper_insert_priv: [ OK ] 1.48 sec. 2026-03-09 10:51:28 02304_orc_arrow_parquet_string_as_string: [ OK ] 0.52 sec. 2026-03-09 10:51:40 02294_overcommit_overflow: [ OK ] 12.47 sec. 2026-03-09 10:52:18 02286_mysql_dump_input_format: [ OK ] 37.63 sec. 2026-03-09 10:52:21 02262_column_ttl: [ OK ] 2.93 sec. 2026-03-09 10:52:42 02247_written_bytes_quota: [ OK ] 21.51 sec. 2026-03-09 10:52:43 02244_lowcardinality_hash_join: [ OK ] 0.53 sec. 127.0.0.1 - - [09/Mar/2026:19:52:49 +0000] "PUT /devstoreaccount1/cont/gzrykiyoncpztcgzhaxonkvujucegqxi HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "PUT /devstoreaccount1/cont/vensoyewizsuiaalewzffykavubkszra HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "PUT /devstoreaccount1/cont/mmmludvhrganqrjvrmqltvrnmmvbcmvh HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "PUT /devstoreaccount1/cont/sxpbcrjyweglcqgsgqypqmysckjkasja HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "PUT /devstoreaccount1/cont/ucgoodbwbntfxlhijdosnjykxyeajhdd HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "PUT /devstoreaccount1/cont/djmtiuakntyfujmosxihpcuvjhulggft HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "PUT /devstoreaccount1/cont/sayuzeyxcuiiyuafymggjywapgbbcoqq HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "PUT /devstoreaccount1/cont/qyessemmkruxcdttlnpsseaicrwahodg HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "PUT /devstoreaccount1/cont/fdbmkvdgjiwxfkuzebrnmhgyhbhthnfc HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "PUT /devstoreaccount1/cont/swmyluosdgpyhkrcgwqtogizgfxddxks HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "GET /devstoreaccount1/cont/mmmludvhrganqrjvrmqltvrnmmvbcmvh HTTP/1.1" 206 520 127.0.0.1 - - [09/Mar/2026:19:52:50 +0000] "GET /devstoreaccount1/cont/vensoyewizsuiaalewzffykavubkszra HTTP/1.1" 206 808111 127.0.0.1 - - [09/Mar/2026:19:52:51 +0000] "DELETE /devstoreaccount1/cont/swmyluosdgpyhkrcgwqtogizgfxddxks HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:52:51 +0000] "DELETE /devstoreaccount1/cont/sayuzeyxcuiiyuafymggjywapgbbcoqq HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:52:51 +0000] "DELETE /devstoreaccount1/cont/ucgoodbwbntfxlhijdosnjykxyeajhdd HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:52:51 +0000] "DELETE /devstoreaccount1/cont/vensoyewizsuiaalewzffykavubkszra HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:52:52 +0000] "DELETE /devstoreaccount1/cont/mmmludvhrganqrjvrmqltvrnmmvbcmvh HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:52:52 +0000] "DELETE /devstoreaccount1/cont/sxpbcrjyweglcqgsgqypqmysckjkasja HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:52:52 +0000] "DELETE /devstoreaccount1/cont/djmtiuakntyfujmosxihpcuvjhulggft HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:52:52 +0000] "DELETE /devstoreaccount1/cont/fdbmkvdgjiwxfkuzebrnmhgyhbhthnfc HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:52:52 +0000] "DELETE /devstoreaccount1/cont/qyessemmkruxcdttlnpsseaicrwahodg HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:52:52 +0000] "DELETE /devstoreaccount1/cont/gzrykiyoncpztcgzhaxonkvujucegqxi HTTP/1.1" 202 - 2026-03-09 10:52:52 02242_system_filesystem_cache_log_table: [ OK ] 8.46 sec. 2026-03-09 10:53:04 02242_delete_user_race: [ OK ] 12.12 sec. 127.0.0.1 - - [09/Mar/2026:19:53:21 +0000] "PUT /devstoreaccount1/cont/geygffmpdvfhxpcgzprbqcctutccozbc HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:23 +0000] "PUT /devstoreaccount1/cont/slalpssjviigoerlapqfdycchflptltt HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:23 +0000] "PUT /devstoreaccount1/cont/xdrgnfqquoooiutkothunptryylazysd HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:23 +0000] "PUT /devstoreaccount1/cont/qyuzkknlatnbabaixdifilrvuhlwuczi HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:23 +0000] "PUT /devstoreaccount1/cont/xejstsyijklxguudpxvllafwbkvkvvmb HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:23 +0000] "PUT /devstoreaccount1/cont/ldgsjzbxtefkhnafabgzdhkgapnjuhmk HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:23 +0000] "PUT /devstoreaccount1/cont/somluozwadgkqjhccwhzhrfleqronxtn HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:23 +0000] "PUT /devstoreaccount1/cont/vazmhykpiffjhmtadtenzjjhntanqbik HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:23 +0000] "PUT /devstoreaccount1/cont/ghebvejojyxvhuzbmlewgznmdatbfiml HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:25 +0000] "PUT /devstoreaccount1/cont/egrqyoqnwnepuoxxzgrbiredbmsgecgf HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:25 +0000] "PUT /devstoreaccount1/cont/vgekmfkejnvmbklmatrvreimmixygnmn HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:25 +0000] "PUT /devstoreaccount1/cont/eyvibiuifgblxhqorufehxwslrjtshjp HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:25 +0000] "PUT /devstoreaccount1/cont/srnbeoltwcudaxtfnlsekicyaimgabhu HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:25 +0000] "PUT /devstoreaccount1/cont/lpziaxmsyprpeycxgbzrputfvcnrgfam HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:25 +0000] "PUT /devstoreaccount1/cont/ideirkaowjebylnqpzlatdinvwwgfeno HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:25 +0000] "PUT /devstoreaccount1/cont/fjvpnhovkhlmqheemfzzycbzvuhhfhae HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:25 +0000] "PUT /devstoreaccount1/cont/xlwcxlyxhyisrrngavzdafapbnsybasz HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/uxsjwukecqbxvavxqfrxnnulcsleahcb HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/zhfiydjgksfbpxbainyiachbypvaoyjb HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/clqpxhgcmabzbflmtvfpuuzbwcrmhoji HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/rigbeygzcoizltnzhrkrbyueqqjlafie HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/fffphyenazkfxmnrbbcxcntngrabqgvo HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/saicgtyniejbbcsijiqpzefsqsvgbuvp HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/bbwkqrqrkuiiuldthtspcsnuntxmsxdq HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/uungvtbueytrmguxaxvjroconywjpmbe HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/jzffwznijcadvjytftlrqpcnswuzjhej HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/jvhxzanibeyldmyniyqmkpdzwcmwrtih HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/rvecpezblpyfnshziggmriywffppyqxx HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/uasjysjmumpknyngcimanmbxleqcjsqb HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/lyhtbitmzkpiyajayikborudcipbnlsx HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/cxwztjpocavjdhpuaftccqdvjkthvgpg HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/yrycaxkkvpbknvclhzpgqjipespojbwh HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:26 +0000] "PUT /devstoreaccount1/cont/ooggxcfwogcxduuyjwgfpgfcstdhkqqs HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/okllbpjgttghexmzgsapdszdhuxhparv HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/kdqcpdilrpstfvgyusdumlnxigjqltrx HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/amzgakqsysexsqijxuethnqvidxoynbw HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/vsabzhzulrzgtamihcfsvjbjggvipish HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/ggbzfihuemlyejjflexnsslhpzyfzzho HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/ukutdnnyhkjpctwdadletsvadmilsitg HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/mdivrutbtwdudqkbopdjppwgfryemmml HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/gcornmhzduxrikgngounpllitrqsnmrn HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "GET /devstoreaccount1/cont/zhfiydjgksfbpxbainyiachbypvaoyjb HTTP/1.1" 206 80 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "GET /devstoreaccount1/cont/slalpssjviigoerlapqfdycchflptltt HTTP/1.1" 206 746 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "GET /devstoreaccount1/cont/uxsjwukecqbxvavxqfrxnnulcsleahcb HTTP/1.1" 206 746 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/afxwkvkckwofdzpwtkuijdrgdipsonph HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/vdejgpzdmwwhgcieihztotlebznzruol HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/npcqsgzwxpnpyvezfgigorltwogxabsk HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/cthfvqsbqpthrdmechqcmqasngnahist HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/jwpecbrkbvsnbeiqzmkryeymrvirxibm HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/avnbjkugtvpcwdfogtmgewdtfmjpzaoc HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/akfpkpniouilxyzazljhcpyutmsewysw HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/mpernxwoeiodvgibyzdrencfflfugsfm HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:27 +0000] "PUT /devstoreaccount1/cont/tozotvqnojsimyfsekoodmeensuvxczd HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/ivqgrzqdfrcjfmujqurgeqqfxyncpnvx HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/dzjqckmkwohwoufjmykrnmxbgpecxcqo HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/eeffbufzovlnvqcfefthstvsgrtqlmiy HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/mesesyjjyhigeodjtficrgbqcuvkldaq HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/zrgkumarsggciwgpocclapmyhfkebtjl HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/isyyagmdwshikqyqxizhuzdhdmctqmll HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/bipusqykqrqnkyjjigsxcticghvwqlxb HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/avzenlrzverqvkvvbqmbmvcxgnhvwnkt HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/kmqwpfpcpykflicfshycvrhtpklafhrc HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/qbnalobvxguejuwigpnmpaexwsmlpdiv HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/sfdullckkszqjalnzpozomrxakzbcrpj HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/faqinzfvqmnqvjksxbrvagyncpryfjfr HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/unwrvptxrwfndnnbahkunappzgfbpvrs HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/uporlgsdswbdrbaltguzxfujhrxgafyt HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/oiatmkyadcmqqgxwtdotcvwbfqouxzkr HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/nqlratwhbsosffhkkhaqhckevepqyapt HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/ngoepxtpxuwtxpcialcpifuwmzecmlzc HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/wxcgpijaovkaxxosnqecyavhajfrbnwt HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/nuezcseldwcezvkkpjxydcbvelcrlcvn HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/qfclpjlhvxbzapbguylqhijddmzkfpjk HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:28 +0000] "PUT /devstoreaccount1/cont/oesvifdxiuhbgmhjhggqjmquinkexfmi HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/mxazjlobdjdxxbomwmqzrdplalnidiqp HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/rplmktijjusfmzbteksxbnvyajbazvcr HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/baatzaqnpptjlkogbwfkvvdxufezvkyv HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/hwwvpghnplerncamjzhuxuzslfpkaalc HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/kljxgrnvqtrecdxvionmebfgnkfpztqd HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/fogbfgxfudovtzwuumogoivzwywutnit HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/muhhndcbrsaotzfuzwqcozzgjfhllknd HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/nubrhgkmlbkpwfvgcemdyfzicqzyokxa HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/wtmzwodwkekzoszifbjaoqqahcobtyfo HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/tcscyautsvilikameofneyjzdmseedhd HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/jzrolbygtevitmssfhormlcgztvraagu HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/qjvnmuelkbuurzuijumqcjejwwtuwpgm HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/kedjpikxqhhxxqzazplkgrerbjdtmhst HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/lbfnqzfksotnkhqayijdnajanfaemmew HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/ekkmdwelmlticjwfuwvfvitlzpkipewc HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/lhprbkyeilyiptdypqarzpyxyaucniao HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/hkmuixhnesyjvpsnxqlbbgylolbgfapk HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/rbazewibryuuwrimzyypnmrfxrizbzfn HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/tuvzcssgfvsqvwizqygrkmtkbpqxairu HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/xinbvssbokjcjziaduvqaydbbanrbjic HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/dpmcricfvfitcbldsrkgftplzfjbpkva HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/efjvzaeiiwvhocroqmmeahkfwnhsfiry HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/squfhioexkdowjuptxvnfenfpgqzdakz HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/drpowlwbroggeivkdffhkutyonnytkaz HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/qxrhqndipegtlernwjenirjexetpwpjs HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/uimgcxryyjfzfhygamrzabexiurkqrgo HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/beeosuqlqwevsaonzmpmdqsboknxdxja HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/ybkuqdtkjuxnkrmgcuecfekvapgsdrsy HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/rhrpkovyounmrnkpnjdfjavhqmdrehsb HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/mhgbanncjleufzrhldurabiqynkevhvr HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/fbphqivqcjpoqvgadvhwjtopnqxyboau HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/htivxsdmcppqkbwlydscslhxsrdgbrfp HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/cbhklpvcwohedpqoziigoofltolbqgqp HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/oczfjjddvpaydcedpmnkdnasgytowapa HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/emnoxejtegmlpmrtknhyrwibkgoajtuu HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/ychjkahrclenioqgaswarjhrbtbgpdtm HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:29 +0000] "PUT /devstoreaccount1/cont/xeuphsmimewoxmkfryzjkigngtfvjhfp HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "PUT /devstoreaccount1/cont/ldbjowsrkiudumbeqsobrlhsdxenuqbr HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "PUT /devstoreaccount1/cont/rpluwiqngrxiooatsbbakhqelpphpejs HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "PUT /devstoreaccount1/cont/qvurtyfgmdnlthkomcrpuxhpjwsowrsh HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "PUT /devstoreaccount1/cont/hwfwbvillmzzsdepzsqghthskcurkqjz HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "PUT /devstoreaccount1/cont/xtpxbrvdzoozuactlsywdxnlvlyhwaqq HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "PUT /devstoreaccount1/cont/jyzwcdrvjfdsztvktzvempplqfkotmmr HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "PUT /devstoreaccount1/cont/cdvtwdajjghqgjpwsvxiaidacowcplpz HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "PUT /devstoreaccount1/cont/ubdiemeinfqicuhoasfteqwwmvluujdm HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "PUT /devstoreaccount1/cont/tovsoniygxpmxiobgaelbcrhsjfcntdl HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "PUT /devstoreaccount1/cont/cgfwkjuoontdxhcdommlcwhegujxadct HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "DELETE /devstoreaccount1/cont/cgfwkjuoontdxhcdommlcwhegujxadct HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "DELETE /devstoreaccount1/cont/ldbjowsrkiudumbeqsobrlhsdxenuqbr HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "DELETE /devstoreaccount1/cont/jyzwcdrvjfdsztvktzvempplqfkotmmr HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "DELETE /devstoreaccount1/cont/rpluwiqngrxiooatsbbakhqelpphpejs HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "DELETE /devstoreaccount1/cont/cdvtwdajjghqgjpwsvxiaidacowcplpz HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "DELETE /devstoreaccount1/cont/xtpxbrvdzoozuactlsywdxnlvlyhwaqq HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "DELETE /devstoreaccount1/cont/qvurtyfgmdnlthkomcrpuxhpjwsowrsh HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:30 +0000] "DELETE /devstoreaccount1/cont/hwfwbvillmzzsdepzsqghthskcurkqjz HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/tovsoniygxpmxiobgaelbcrhsjfcntdl HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ubdiemeinfqicuhoasfteqwwmvluujdm HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ghebvejojyxvhuzbmlewgznmdatbfiml HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ldgsjzbxtefkhnafabgzdhkgapnjuhmk HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/xejstsyijklxguudpxvllafwbkvkvvmb HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/slalpssjviigoerlapqfdycchflptltt HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/xdrgnfqquoooiutkothunptryylazysd HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/qyuzkknlatnbabaixdifilrvuhlwuczi HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/vazmhykpiffjhmtadtenzjjhntanqbik HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/somluozwadgkqjhccwhzhrfleqronxtn HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/mpernxwoeiodvgibyzdrencfflfugsfm HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/jwpecbrkbvsnbeiqzmkryeymrvirxibm HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/cthfvqsbqpthrdmechqcmqasngnahist HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/afxwkvkckwofdzpwtkuijdrgdipsonph HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/vdejgpzdmwwhgcieihztotlebznzruol HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/npcqsgzwxpnpyvezfgigorltwogxabsk HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/akfpkpniouilxyzazljhcpyutmsewysw HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/avnbjkugtvpcwdfogtmgewdtfmjpzaoc HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/avzenlrzverqvkvvbqmbmvcxgnhvwnkt HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/zrgkumarsggciwgpocclapmyhfkebtjl HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/mesesyjjyhigeodjtficrgbqcuvkldaq HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ivqgrzqdfrcjfmujqurgeqqfxyncpnvx HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/dzjqckmkwohwoufjmykrnmxbgpecxcqo HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/eeffbufzovlnvqcfefthstvsgrtqlmiy HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/bipusqykqrqnkyjjigsxcticghvwqlxb HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/isyyagmdwshikqyqxizhuzdhdmctqmll HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/xlwcxlyxhyisrrngavzdafapbnsybasz HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/lpziaxmsyprpeycxgbzrputfvcnrgfam HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/srnbeoltwcudaxtfnlsekicyaimgabhu HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/egrqyoqnwnepuoxxzgrbiredbmsgecgf HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/vgekmfkejnvmbklmatrvreimmixygnmn HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/eyvibiuifgblxhqorufehxwslrjtshjp HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/fjvpnhovkhlmqheemfzzycbzvuhhfhae HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ideirkaowjebylnqpzlatdinvwwgfeno HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/uungvtbueytrmguxaxvjroconywjpmbe HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/fffphyenazkfxmnrbbcxcntngrabqgvo HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/rigbeygzcoizltnzhrkrbyueqqjlafie HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/uxsjwukecqbxvavxqfrxnnulcsleahcb HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/zhfiydjgksfbpxbainyiachbypvaoyjb HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/clqpxhgcmabzbflmtvfpuuzbwcrmhoji HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/bbwkqrqrkuiiuldthtspcsnuntxmsxdq HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/saicgtyniejbbcsijiqpzefsqsvgbuvp HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ooggxcfwogcxduuyjwgfpgfcstdhkqqs HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/lyhtbitmzkpiyajayikborudcipbnlsx HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/uasjysjmumpknyngcimanmbxleqcjsqb HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/jzffwznijcadvjytftlrqpcnswuzjhej HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/jvhxzanibeyldmyniyqmkpdzwcmwrtih HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/rvecpezblpyfnshziggmriywffppyqxx HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/yrycaxkkvpbknvclhzpgqjipespojbwh HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/cxwztjpocavjdhpuaftccqdvjkthvgpg HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/gcornmhzduxrikgngounpllitrqsnmrn HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ggbzfihuemlyejjflexnsslhpzyfzzho HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/vsabzhzulrzgtamihcfsvjbjggvipish HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/okllbpjgttghexmzgsapdszdhuxhparv HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/kdqcpdilrpstfvgyusdumlnxigjqltrx HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/amzgakqsysexsqijxuethnqvidxoynbw HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/mdivrutbtwdudqkbopdjppwgfryemmml HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ukutdnnyhkjpctwdadletsvadmilsitg HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/wxcgpijaovkaxxosnqecyavhajfrbnwt HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/kmqwpfpcpykflicfshycvrhtpklafhrc HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/uporlgsdswbdrbaltguzxfujhrxgafyt HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/qbnalobvxguejuwigpnmpaexwsmlpdiv HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/oiatmkyadcmqqgxwtdotcvwbfqouxzkr HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/unwrvptxrwfndnnbahkunappzgfbpvrs HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/sfdullckkszqjalnzpozomrxakzbcrpj HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/faqinzfvqmnqvjksxbrvagyncpryfjfr HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ngoepxtpxuwtxpcialcpifuwmzecmlzc HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/nqlratwhbsosffhkkhaqhckevepqyapt HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/muhhndcbrsaotzfuzwqcozzgjfhllknd HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/nuezcseldwcezvkkpjxydcbvelcrlcvn HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/baatzaqnpptjlkogbwfkvvdxufezvkyv HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/qfclpjlhvxbzapbguylqhijddmzkfpjk HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/hwwvpghnplerncamjzhuxuzslfpkaalc HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/rplmktijjusfmzbteksxbnvyajbazvcr HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/oesvifdxiuhbgmhjhggqjmquinkexfmi HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/mxazjlobdjdxxbomwmqzrdplalnidiqp HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/fogbfgxfudovtzwuumogoivzwywutnit HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/kljxgrnvqtrecdxvionmebfgnkfpztqd HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/hkmuixhnesyjvpsnxqlbbgylolbgfapk HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/nubrhgkmlbkpwfvgcemdyfzicqzyokxa HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/kedjpikxqhhxxqzazplkgrerbjdtmhst HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/wtmzwodwkekzoszifbjaoqqahcobtyfo HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/lbfnqzfksotnkhqayijdnajanfaemmew HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/qjvnmuelkbuurzuijumqcjejwwtuwpgm HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/tcscyautsvilikameofneyjzdmseedhd HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/jzrolbygtevitmssfhormlcgztvraagu HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/lhprbkyeilyiptdypqarzpyxyaucniao HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ekkmdwelmlticjwfuwvfvitlzpkipewc HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/beeosuqlqwevsaonzmpmdqsboknxdxja HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/rbazewibryuuwrimzyypnmrfxrizbzfn HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/squfhioexkdowjuptxvnfenfpgqzdakz HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/tuvzcssgfvsqvwizqygrkmtkbpqxairu HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/drpowlwbroggeivkdffhkutyonnytkaz HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/efjvzaeiiwvhocroqmmeahkfwnhsfiry HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/xinbvssbokjcjziaduvqaydbbanrbjic HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/dpmcricfvfitcbldsrkgftplzfjbpkva HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/uimgcxryyjfzfhygamrzabexiurkqrgo HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/qxrhqndipegtlernwjenirjexetpwpjs HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/xeuphsmimewoxmkfryzjkigngtfvjhfp HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ybkuqdtkjuxnkrmgcuecfekvapgsdrsy HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/cbhklpvcwohedpqoziigoofltolbqgqp HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/rhrpkovyounmrnkpnjdfjavhqmdrehsb HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/oczfjjddvpaydcedpmnkdnasgytowapa HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/htivxsdmcppqkbwlydscslhxsrdgbrfp HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/mhgbanncjleufzrhldurabiqynkevhvr HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/fbphqivqcjpoqvgadvhwjtopnqxyboau HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/ychjkahrclenioqgaswarjhrbtbgpdtm HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/emnoxejtegmlpmrtknhyrwibkgoajtuu HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/geygffmpdvfhxpcgzprbqcctutccozbc HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:31 +0000] "DELETE /devstoreaccount1/cont/tozotvqnojsimyfsekoodmeensuvxczd HTTP/1.1" 202 - 2026-03-09 10:53:31 02241_filesystem_cache_on_write_operations: [ OK ] 26.73 sec. 2026-03-09 10:53:31 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.38 sec. 2026-03-09 10:53:32 02240_filesystem_query_cache: [ OK ] 0.47 sec. 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "PUT /devstoreaccount1/cont/pntapgadcbdivhawpnwmxkadjbeurwlk HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "PUT /devstoreaccount1/cont/komqxcjfpalvobwdcynkcjqqgbbigpez HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "PUT /devstoreaccount1/cont/hardktzwcoieptlbidfdbqinmxqysgwz HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "PUT /devstoreaccount1/cont/epdtklstkmpjrtsqxkbwidmgewvodczn HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "PUT /devstoreaccount1/cont/jbbiqdzmnyvxxyxvzgbzikpuxibmmiiw HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "PUT /devstoreaccount1/cont/vplmxwdzszliqrezoikdspbvdtefzgkv HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "PUT /devstoreaccount1/cont/kvxfrbyhqbhmvwmdnnfkfgstrtkerdea HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "PUT /devstoreaccount1/cont/nzurchwlrrigglmvjumpxirmyfivomje HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "PUT /devstoreaccount1/cont/lnbwepedocfgcaywvdhqlrmduftshhaw HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "PUT /devstoreaccount1/cont/mqasrtaefrhvjarjlebvsrlaccaqddxy HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "GET /devstoreaccount1/cont/hardktzwcoieptlbidfdbqinmxqysgwz HTTP/1.1" 206 80 127.0.0.1 - - [09/Mar/2026:19:53:40 +0000] "GET /devstoreaccount1/cont/komqxcjfpalvobwdcynkcjqqgbbigpez HTTP/1.1" 206 746 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "GET /devstoreaccount1/cont/hardktzwcoieptlbidfdbqinmxqysgwz HTTP/1.1" 206 80 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "GET /devstoreaccount1/cont/komqxcjfpalvobwdcynkcjqqgbbigpez HTTP/1.1" 206 746 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "DELETE /devstoreaccount1/cont/mqasrtaefrhvjarjlebvsrlaccaqddxy HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "DELETE /devstoreaccount1/cont/kvxfrbyhqbhmvwmdnnfkfgstrtkerdea HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "DELETE /devstoreaccount1/cont/jbbiqdzmnyvxxyxvzgbzikpuxibmmiiw HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "DELETE /devstoreaccount1/cont/komqxcjfpalvobwdcynkcjqqgbbigpez HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "DELETE /devstoreaccount1/cont/hardktzwcoieptlbidfdbqinmxqysgwz HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "DELETE /devstoreaccount1/cont/epdtklstkmpjrtsqxkbwidmgewvodczn HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "DELETE /devstoreaccount1/cont/vplmxwdzszliqrezoikdspbvdtefzgkv HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "DELETE /devstoreaccount1/cont/lnbwepedocfgcaywvdhqlrmduftshhaw HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "DELETE /devstoreaccount1/cont/nzurchwlrrigglmvjumpxirmyfivomje HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:42 +0000] "DELETE /devstoreaccount1/cont/pntapgadcbdivhawpnwmxkadjbeurwlk HTTP/1.1" 202 - 2026-03-09 10:53:42 02240_system_filesystem_cache_table: [ OK ] 10.42 sec. 2026-03-09 10:53:42 02232_dist_insert_send_logs_level_hung: [ SKIPPED ] 0.00 sec. 2026-03-09 10:53:42 Reason: disabled 2026-03-09 10:53:44 02227_test_create_empty_sqlite_db: [ OK ] 2.18 sec. 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "PUT /devstoreaccount1/cont/rczdepqitygebhusgqhdthxfjxqsxjsn HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "PUT /devstoreaccount1/cont/dtucnzvleiuarsjrwxffcryajmythpet HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "PUT /devstoreaccount1/cont/loglgygyvpuyvdobtjnvatyrhteevfcb HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "PUT /devstoreaccount1/cont/kdbqtfmjmjatnjcbzecvhhgxjvljzksa HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "PUT /devstoreaccount1/cont/lphyvmfuybsktsamoxhcurvhtrhnumog HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "PUT /devstoreaccount1/cont/lufkszvpdhueyvndafvtopfirjntepzc HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "PUT /devstoreaccount1/cont/mgppcacrvxbjosndjxaswydsytdxakeg HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "PUT /devstoreaccount1/cont/wmzyxuqvtuflzmzzbdkgrniltfpmtlil HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "PUT /devstoreaccount1/cont/latvvmwxijdqjtjiiwztbegsvkhljhag HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "PUT /devstoreaccount1/cont/hdteecxfelfghjgprnfqtbgbwclkuctz HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "GET /devstoreaccount1/cont/loglgygyvpuyvdobtjnvatyrhteevfcb HTTP/1.1" 206 62 127.0.0.1 - - [09/Mar/2026:19:53:51 +0000] "GET /devstoreaccount1/cont/dtucnzvleiuarsjrwxffcryajmythpet HTTP/1.1" 206 100465 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/fyevsaugcrlxfmohkrgnenlaftxgxrsl HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/kngbdlzahrftleugwelrsvedxvyaduxx HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/ekeznonhjmxvedwtfcaytsmkqjxxpfps HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/jxxxltytnzvzbqknghvsgdmiwfvbzobn HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/dqtywxhkgpyrmpjswvhzrrjpejrtylrv HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/hdteecxfelfghjgprnfqtbgbwclkuctz HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/mgppcacrvxbjosndjxaswydsytdxakeg HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/lphyvmfuybsktsamoxhcurvhtrhnumog HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/loglgygyvpuyvdobtjnvatyrhteevfcb HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/dtucnzvleiuarsjrwxffcryajmythpet HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/kdbqtfmjmjatnjcbzecvhhgxjvljzksa HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/lufkszvpdhueyvndafvtopfirjntepzc HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/latvvmwxijdqjtjiiwztbegsvkhljhag HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/wmzyxuqvtuflzmzzbdkgrniltfpmtlil HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/thjazuzsjgooiogoorxrqdhlzscuvcpt HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/fagbitgomnlmqdyctglowohxrmgfooxi HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/ntvejbhncdtxotgupgesmsbmvktowock HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/rsgjfrtayrebhuwresstmnrfyrnpnfmo HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/bicqssvrjqnlczaifqsuujtwqodnhlzn HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/eegzdzervtlnoedrhoqkvrowbkzjqmwu HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/bhifscxwzkxgtvmzqyunituzrizexwbg HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/dsvgpksuskajrwzeothcgwmtyewpeuzr HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "PUT /devstoreaccount1/cont/njwhgbklfgsvgyjdvuftkowmflbwqvay HTTP/1.1" 201 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/dqtywxhkgpyrmpjswvhzrrjpejrtylrv HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/kngbdlzahrftleugwelrsvedxvyaduxx HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/fyevsaugcrlxfmohkrgnenlaftxgxrsl HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/oqnxmhgblpshkzzuxsdskdkjnyejlxcn HTTP/1.1" 404 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/xlrcmkgvtztqfbsqiusnxawupcxuqxfs HTTP/1.1" 404 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/iptssytxldiwxluzsxmxvrkueprkdcjv HTTP/1.1" 404 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/jxxxltytnzvzbqknghvsgdmiwfvbzobn HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/ekeznonhjmxvedwtfcaytsmkqjxxpfps HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/njwhgbklfgsvgyjdvuftkowmflbwqvay HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/eegzdzervtlnoedrhoqkvrowbkzjqmwu HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/rsgjfrtayrebhuwresstmnrfyrnpnfmo HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/fagbitgomnlmqdyctglowohxrmgfooxi HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/thjazuzsjgooiogoorxrqdhlzscuvcpt HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/ntvejbhncdtxotgupgesmsbmvktowock HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/bicqssvrjqnlczaifqsuujtwqodnhlzn HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/dsvgpksuskajrwzeothcgwmtyewpeuzr HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/bhifscxwzkxgtvmzqyunituzrizexwbg HTTP/1.1" 202 - 127.0.0.1 - - [09/Mar/2026:19:53:53 +0000] "DELETE /devstoreaccount1/cont/rczdepqitygebhusgqhdthxfjxqsxjsn HTTP/1.1" 202 - 2026-03-09 10:53:53 02226_filesystem_cache_profile_events: [ OK ] 8.96 sec. 2026-03-09 10:53:55 02225_unwinder_dwarf_version: [ OK ] 1.28 sec. 2026-03-09 10:54:00 02222_create_table_without_columns_metadata: [ OK ] 5.30 sec. 2026-03-09 10:54:03 02207_allow_plaintext_and_no_password: [ OK ] 3.34 sec. 2026-03-09 10:54:06 02185_values_schema_inference: [ OK ] 2.83 sec. 2026-03-09 10:54:08 02184_ipv6_parsing: [ OK ] 1.68 sec. 2026-03-09 10:54:09 02182_json_each_row_schema_inference: [ OK ] 1.28 sec. 2026-03-09 10:54:10 02179_dict_reload_on_cluster: [ OK ] 0.73 sec. 2026-03-09 10:54:11 02177_temporary_table_current_database_http_session: [ OK ] 0.98 sec. 2026-03-09 10:54:12 02168_avro_bug: [ OK ] 0.58 sec. 2026-03-09 10:54:13 02166_arrow_dictionary_inference: [ OK ] 1.73 sec. 2026-03-09 10:54:14 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 0.83 sec. 2026-03-09 10:54:15 02148_sql_user_defined_function_subquery: [ OK ] 0.58 sec. 2026-03-09 10:54:16 02126_identity_user_defined_function: [ OK ] 0.57 sec. 2026-03-09 10:54:16 02125_recursive_sql_user_defined_functions: [ OK ] 0.58 sec. 2026-03-09 10:54:16 02125_many_mutations_2: [ SKIPPED ] 0.00 sec. 2026-03-09 10:54:16 Reason: not running for current build 2026-03-09 10:54:19 02105_table_function_file_partiotion_by: [ OK ] 2.48 sec. 2026-03-09 10:54:20 02104_json_strings_nullable_string: [ OK ] 1.63 sec. 2026-03-09 10:54:21 02103_sql_user_defined_functions_composition: [ OK ] 0.47 sec. 2026-03-09 10:54:30 02103_tsv_csv_custom_null_representation: [ OK ] 9.21 sec. 2026-03-09 10:54:31 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 0.48 sec. 2026-03-09 10:54:31 02098_sql_user_defined_functions_aliases: [ OK ] 0.48 sec. 2026-03-09 10:54:31 02096_sql_user_defined_function_alias: [ OK ] 0.43 sec. 2026-03-09 10:54:32 02096_rename_atomic_hang: [ OK ] 0.62 sec. 2026-03-09 10:54:35 02051_read_settings: [ OK ] 2.69 sec. 2026-03-09 10:54:36 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 0.98 sec. 2026-03-09 10:54:50 02026_storage_filelog_largefile: [ OK ] 13.98 sec. 2026-03-09 10:54:50 02025_dictionary_view_different_db: [ OK ] 0.63 sec. 2026-03-09 10:54:51 02015_column_default_dict_get_identifier: [ OK ] 0.58 sec. 2026-03-09 10:54:54 02015_global_in_threads: [ OK ] 2.53 sec. 2026-03-09 10:54:54 02011_dictionary_empty_attribute_list: [ OK ] 0.52 sec. 2026-03-09 10:54:55 01999_grant_with_replace: [ OK ] 0.58 sec. 2026-03-09 10:54:55 01948_dictionary_quoted_database_name: [ OK ] 0.58 sec. 2026-03-09 10:54:56 01915_create_or_replace_dictionary: [ OK ] 0.63 sec. 2026-03-09 10:54:57 01913_exact_rows_before_limit_full: [ OK ] 0.68 sec. 2026-03-09 10:54:57 01910_view_dictionary: [ OK ] 0.62 sec. 2026-03-09 10:54:59 01903_ssd_cache_dictionary_array_type: [ OK ] 1.43 sec. 2026-03-09 10:55:00 01902_table_function_merge_db_repr: [ OK ] 0.78 sec. 2026-03-09 10:55:00 01901_test_attach_partition_from: [ OK ] 0.83 sec. 2026-03-09 10:55:02 01889_postgresql_protocol_null_fields: [ OK ] 1.33 sec. 2026-03-09 10:55:02 01870_buffer_flush: [ OK ] 0.53 sec. 2026-03-09 10:55:03 01856_create_function: [ OK ] 0.63 sec. 2026-03-09 10:55:06 01853_dictionary_cache_duplicates: [ OK ] 2.53 sec. 2026-03-09 10:55:06 01850_dist_INSERT_preserve_error: [ OK ] 0.62 sec. 2026-03-09 10:55:07 01837_database_memory_ddl_dictionaries: [ OK ] 0.53 sec. 2026-03-09 10:55:07 01821_table_comment: [ OK ] 0.68 sec. 2026-03-09 10:55:08 01785_dictionary_element_count: [ OK ] 0.78 sec. 2026-03-09 10:55:09 01778_hierarchical_dictionaries: [ OK ] 0.93 sec. 2026-03-09 10:55:10 01754_direct_dictionary_complex_key: [ OK ] 1.18 sec. 2026-03-09 10:55:12 01753_direct_dictionary_simple_key: [ OK ] 1.13 sec. 2026-03-09 10:55:13 01747_executable_pool_dictionary_implicit_key: [ OK ] 1.63 sec. 2026-03-09 10:55:15 01746_executable_pool_dictionary: [ OK ] 1.53 sec. 2026-03-09 10:55:17 01737_clickhouse_server_wait_server_pool_long: [ OK ] 2.48 sec. 2026-03-09 10:55:20 01722_long_brotli_http_compression_json_format: [ OK ] 2.18 sec. 2026-03-09 10:55:20 01721_engine_file_truncate_on_insert: [ OK ] 0.57 sec. 2026-03-09 10:55:25 01710_projection_vertical_merges: [ OK ] 4.94 sec. 2026-03-09 10:55:26 01681_cache_dictionary_simple_key: [ OK ] 1.18 sec. 2026-03-09 10:55:27 01676_dictget_in_default_expression: [ OK ] 0.78 sec. 2026-03-09 10:55:28 01670_dictionary_create_key_expression: [ OK ] 0.63 sec. 2026-03-09 10:55:28 01646_system_restart_replicas_smoke: [ OK ] 0.63 sec. 2026-03-09 10:55:31 01643_replicated_merge_tree_fsync_smoke: [ OK ] 2.08 sec. 2026-03-09 10:55:31 01615_random_one_shard_insertion: [ OK ] 0.77 sec. 2026-03-09 10:55:32 01603_rename_overwrite_bug: [ OK ] 0.83 sec. 2026-03-09 10:56:07 01600_detach_permanently: [ OK ] 34.59 sec. 2026-03-09 10:56:59 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 52.32 sec. 2026-03-09 10:57:00 01575_disable_detach_table_of_dictionary: [ OK ] 0.47 sec. 2026-03-09 10:57:01 01530_drop_database_atomic_sync: [ OK ] 0.88 sec. 2026-03-09 10:57:02 01527_clickhouse_local_optimize: [ OK ] 1.33 sec. 2026-03-09 10:57:03 01526_complex_key_dict_direct_layout: [ OK ] 0.57 sec. 2026-03-09 10:57:04 01524_do_not_merge_across_partitions_select_final: [ OK ] 1.38 sec. 2026-03-09 10:57:05 01517_drop_mv_with_inner_table: [ OK ] 0.68 sec. 2026-03-09 10:57:08 01507_clickhouse_server_start_with_embedded_config: [ OK ] 3.18 sec. 2026-03-09 10:57:10 01501_cache_dictionary_all_fields: [ OK ] 1.88 sec. 2026-03-09 10:57:13 01474_executable_dictionary: [ OK ] 3.24 sec. 2026-03-09 10:57:14 01471_calculate_ttl_during_merge: [ OK ] 0.68 sec. 2026-03-09 10:57:38 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 23.86 sec. 2026-03-09 10:57:38 01459_manual_write_to_replicas: [ SKIPPED ] 0.00 sec. 2026-03-09 10:57:38 Reason: not running for current build 2026-03-09 10:57:38 01457_create_as_table_function_structure: [ OK ] 0.52 sec. 2026-03-09 10:57:39 01455_rank_correlation_spearman: [ OK ] 0.58 sec. 2026-03-09 10:58:00 01454_storagememory_data_race_challenge: [ OK ] 21.41 sec. 2026-03-09 10:58:06 01417_freeze_partition_verbose_zookeeper: [ OK ] 5.70 sec. 2026-03-09 10:58:16 01417_freeze_partition_verbose: [ OK ] 9.87 sec. 2026-03-09 10:59:02 01414_mutations_and_errors_zookeeper: [ OK ] 45.96 sec. 2026-03-09 10:59:05 01410_nullable_key_more_tests: [ OK ] 2.79 sec. 2026-03-09 10:59:11 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 6.00 sec. 2026-03-09 10:59:13 01360_materialized_view_with_join_on_query_log: [ OK ] 2.38 sec. 2026-03-09 10:59:14 01356_view_threads: [ OK ] 0.93 sec. 2026-03-09 10:59:26 01320_create_sync_race_condition_zookeeper: [ OK ] 12.23 sec. 2026-03-09 10:59:33 01307_multiple_leaders_zookeeper: [ OK ] 6.45 sec. 2026-03-09 10:59:44 01305_replica_create_drop_zookeeper: [ OK ] 11.67 sec. 2026-03-09 11:00:16 01301_aggregate_state_exception_memory_leak: [ OK ] 31.10 sec. 2026-03-09 11:00:17 01297_create_quota: [ OK ] 1.33 sec. 2026-03-09 11:00:18 01295_create_row_policy: [ OK ] 0.77 sec. 2026-03-09 11:00:18 01294_system_distributed_on_cluster: [ OK ] 0.68 sec. 2026-03-09 11:00:19 01294_create_settings_profile: [ OK ] 0.93 sec. 2026-03-09 11:00:20 01293_system_distribution_queue: [ OK ] 0.57 sec. 2026-03-09 11:00:21 01281_unsucceeded_insert_select_queries_counter: [ OK ] 0.68 sec. 2026-03-09 11:00:25 01281_group_by_limit_memory_tracking: [ OK ] 4.54 sec. 2026-03-09 11:00:29 01280_ssd_complex_key_dictionary: [ OK ] 4.19 sec. 2026-03-09 11:01:10 01275_parallel_mv: [ OK ] 40.69 sec. 2026-03-09 11:01:11 01251_dict_is_in_infinite_loop: [ OK ] 0.92 sec. 2026-03-09 11:01:12 01225_show_create_table_from_dictionary: [ OK ] 0.47 sec. 2026-03-09 11:01:50 01192_rename_database_zookeeper: [ OK ] 38.08 sec. 2026-03-09 11:01:50 01164_alter_memory_database: [ OK ] 0.57 sec. 2026-03-09 11:01:52 01155_rename_move_materialized_view: [ OK ] 1.13 sec. 2026-03-09 11:02:59 01154_move_partition_long: [ OK ] 67.53 sec. 2026-03-09 11:03:00 01153_attach_mv_uuid: [ OK ] 0.83 sec. 2026-03-09 11:03:01 01148_zookeeper_path_macros_unfolding: [ OK ] 1.53 sec. 2026-03-09 11:03:02 01119_weird_user_names: [ OK ] 0.57 sec. 2026-03-09 11:08:26 01111_create_drop_replicated_db_stress: [ OK ] 324.11 sec. 2026-03-09 11:08:27 01110_dictionary_layout_without_arguments: [ OK ] 0.48 sec. 2026-03-09 11:08:28 01103_distributed_product_mode_local_column_renames: [ OK ] 0.83 sec. 2026-03-09 11:08:35 01098_temporary_and_external_tables: [ OK ] 7.30 sec. 2026-03-09 11:08:36 01091_num_threads: [ OK ] 1.24 sec. 2026-03-09 11:08:38 01085_max_distributed_connections_http: [ OK ] 1.88 sec. 2026-03-09 11:09:27 01083_expressions_in_engine_arguments: [ OK ] 48.81 sec. 2026-03-09 11:09:28 01082_window_view_watch_limit: [ OK ] 1.13 sec. 2026-03-09 11:10:00 01079_parallel_alter_detach_table_zookeeper: [ OK ] 31.74 sec. 2026-03-09 11:10:08 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 7.80 sec. 2026-03-09 11:10:10 01075_window_view_proc_tumble_to_now_populate: [ OK ] 2.48 sec. 2026-03-09 11:10:11 01070_materialize_ttl: [ OK ] 1.13 sec. 2026-03-09 11:10:12 01070_mutations_with_dependencies: [ OK ] 0.98 sec. 2026-03-09 11:10:14 01070_modify_ttl: [ OK ] 1.18 sec. 2026-03-09 11:10:23 01069_window_view_proc_tumble_watch: [ OK ] 9.11 sec. 2026-03-09 11:10:24 01065_window_view_event_hop_watch_bounded: [ OK ] 1.38 sec. 2026-03-09 11:10:25 01060_shutdown_table_after_detach: [ OK ] 1.23 sec. 2026-03-09 11:10:31 01055_window_view_proc_hop_to: [ OK ] 5.19 sec. 2026-03-09 11:10:34 01053_ssd_dictionary: [ OK ] 3.04 sec. 2026-03-09 11:10:42 01038_dictionary_lifetime_min_zero_sec: [ OK ] 8.40 sec. 2026-03-09 11:10:43 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 0.63 sec. 2026-03-09 11:10:43 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 0.62 sec. 2026-03-09 11:10:44 01023_materialized_view_query_context: [ OK ] 0.62 sec. 2026-03-09 11:10:57 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 12.96 sec. 2026-03-09 11:11:02 01018_ddl_dictionaries_bad_queries: [ OK ] 4.54 sec. 2026-03-09 11:11:26 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 24.31 sec. 2026-03-09 11:11:43 01014_lazy_database_basic: [ OK ] 17.49 sec. 2026-03-09 11:11:47 01013_sync_replica_timeout_zookeeper: [ OK ] 3.34 sec. 2026-03-09 11:12:00 01007_r1r2_w_r2r1_deadlock: [ OK ] 13.07 sec. 2026-03-09 11:12:14 01004_rename_deadlock: [ OK ] 14.02 sec. 2026-03-09 11:12:15 00985_merge_stack_overflow: [ OK ] 1.33 sec. 2026-03-09 11:12:17 00971_query_id_in_logs: [ OK ] 1.33 sec. 2026-03-09 11:12:17 00963_achimbab: [ OK ] 0.58 sec. 2026-03-09 11:12:18 00950_dict_get: [ OK ] 1.12 sec. 2026-03-09 11:12:21 00877_memory_limit_for_new_delete: [ OK ] 2.38 sec. 2026-03-09 11:12:21 00840_long_concurrent_select_and_drop_deadlock: [ SKIPPED ] 0.00 sec. 2026-03-09 11:12:21 Reason: not running for current build 2026-03-09 11:12:21 00722_inner_join: [ OK ] 0.67 sec. 2026-03-09 11:12:22 00693_max_block_size_system_tables_columns: [ OK ] 0.88 sec. 2026-03-09 11:12:28 00623_truncate_table_throw_exception: [ OK ] 5.65 sec. 2026-03-09 11:12:29 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 1.23 sec. 2026-03-09 11:12:39 00463_long_sessions_in_http_interface: [ OK ] 9.86 sec. 2026-03-09 11:12:40 00332_quantile_timing_memory_leak: [ OK ] 0.57 sec. 2026-03-09 11:12:40 00309_formats_case_insensitive: [ OK ] 0.58 sec. 2026-03-09 11:12:40 00002_log_and_exception_messages_formatting: [ SKIPPED ] 0.00 sec. 2026-03-09 11:12:40 Reason: skip 2026-03-09 11:12:40 2026-03-09 11:12:40 269 tests passed. 12 tests skipped. 1976.77 s elapsed (MainProcess). 2026-03-09 11:12:41 Won't run stateful tests because test data wasn't loaded. 2026-03-09 11:12:41 Checking the hung queries: done 2026-03-09 11:12:41 2026-03-09 11:12:41 No queries hung. 2026-03-09 11:12:41 All tests have finished. 2026-03-09 11:12:41 2026-03-09 11:12:41 Top patterns of log messages: 2026-03-09 11:12:41 2026-03-09 11:12:41 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 2026-03-09 11:12:41 2026-03-09 11:12:41 1. 225436 0.078 9.92 MiB 0.035 1 1136 ['Trace'] 1 is disk {} eligible for search: {} 2026-03-09 11:12:41 2. 121549 0.042 24.08 MiB 0.085 1 347 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {}) 2026-03-09 11:12:41 3. 121482 0.042 18.19 MiB 0.065 37701 344 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {} 2026-03-09 11:12:41 4. 110726 0.038 2.66 MiB 0.009 1 812 ['Trace'] 0.001 Query to stage {}{} 2026-03-09 11:12:41 5. 109368 0.038 5.15 MiB 0.018 1 810 ['Trace'] 0.001 Query from stage {} to stage {}{} 2026-03-09 11:12:41 6. 98007 0.034 2.70 MiB 0.01 1 214 ['Debug'] 0 Processed in {} sec. 2026-03-09 11:12:41 7. 96251 0.033 4.21 MiB 0.015 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {} 2026-03-09 11:12:41 8. 71748 0.025 5.67 MiB 0.02 1 326 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec. 2026-03-09 11:12:41 9. 68238 0.024 2.21 MiB 0.008 1 1391 ['Trace'] 0 Aggregation method: {} 2026-03-09 11:12:41 10. 63373 0.022 5.68 MiB 0.02 1 1386 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.) 2026-03-09 11:12:41 11. 57479 0.02 3.95 MiB 0.014 1 1673 ['Trace'] 0.501 Reserved {} on local disk {}, having unreserved {}. 2026-03-09 11:12:41 12. 54553 0.019 586.02 KiB 0.002 1 1380 ['Trace'] 0 Aggregating 2026-03-09 11:12:41 13. 53681 0.019 6.00 MiB 0.021 2809 1170 ['Trace'] 0.371 Renaming temporary part {} to {} with tid {}. 2026-03-09 11:12:41 14. 51339 0.018 3.48 MiB 0.012 2796 1671 ['Trace'] 0.459 Trying to reserve {} using storage policy from min volume index {} 2026-03-09 11:12:41 15. 49412 0.017 3.93 MiB 0.014 1 1262 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={} 2026-03-09 11:12:41 16. 43350 0.015 1.96 MiB 0.007 1 1168 ['Trace'] 0.17 filled checksums {} 2026-03-09 11:12:41 17. 41335 0.014 1.93 MiB 0.007 1 331 ['Debug'] 0.206 Peak memory usage{}: {}. 2026-03-09 11:12:41 18. 38759 0.013 2.97 MiB 0.011 1567 267 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {} 2026-03-09 11:12:41 19. 38109 0.013 1.73 MiB 0.006 38109 504 ['Debug'] 0.996 Authenticating user '{}' from {} 2026-03-09 11:12:41 20. 38084 0.013 4.18 MiB 0.015 38084 504 ['Debug'] 0.996 {} Authenticated with global context as user {} 2026-03-09 11:12:41 21. 38031 0.013 3.26 MiB 0.012 38031 498 ['Debug'] 0.996 {} Logout, user_id: {} 2026-03-09 11:12:41 22. 37675 0.013 2.69 MiB 0.01 37675 344 ['Debug'] 1 Creating session context with user_id: {} 2026-03-09 11:12:41 23. 33081 0.011 6.64 MiB 0.024 3 321 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {} 2026-03-09 11:12:41 24. 33072 0.011 20.50 MiB 0.073 2 321 ['Trace'] 1 Request URI: {} 2026-03-09 11:12:41 25. 32208 0.011 660.52 KiB 0.002 2 321 ['Debug'] 0.356 Done processing query 2026-03-09 11:12:41 26. 26387 0.009 2.32 MiB 0.008 446 524 ['Trace'] 0.999 Insert entry {} to queue with type {} 2026-03-09 11:12:41 27. 25472 0.009 1.94 MiB 0.007 725 1554 ['Trace'] 0.929 Part {} is not stored on zero-copy replicated disk, blobs can be removed 2026-03-09 11:12:41 28. 24706 0.009 715.74 KiB 0.002 1739 322 ['Debug'] 0.004 Key condition: {} 2026-03-09 11:12:41 29. 23056 0.008 2.08 MiB 0.007 1 101 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part 2026-03-09 11:12:41 30. 22778 0.008 1.89 MiB 0.007 859 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {} 2026-03-09 11:12:41 31. 22512 0.008 2.68 MiB 0.01 1 2 ['Trace'] 1 Creating part at path {} 2026-03-09 11:12:41 32. 22249 0.008 3.02 MiB 0.011 646 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={}) 2026-03-09 11:12:41 33. 22163 0.008 973.96 KiB 0.003 1734 322 ['Trace'] 0.005 Filtering marks by primary and secondary keys 2026-03-09 11:12:41 34. 22048 0.008 495.22 KiB 0.002 1 1199 ['Trace'] 0.001 Merging aggregated data 2026-03-09 11:12:41 35. 21879 0.008 2.44 MiB 0.009 1727 322 ['Debug'] 0.005 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges 2026-03-09 11:12:41 36. 20306 0.007 1.03 MiB 0.004 1503 322 ['Trace'] 0.005 Spreading mark ranges among streams (default reading) 2026-03-09 11:12:41 37. 20191 0.007 512.66 KiB 0.002 446 524 ['Debug'] 0.999 Pulled {} entries to queue. 2026-03-09 11:12:41 38. 20191 0.007 1.14 MiB 0.004 446 524 ['Debug'] 0.999 Pulling {} entries to queue: {} - {} 2026-03-09 11:12:41 39. 17102 0.006 561.16 KiB 0.002 2 222 ['Trace'] 1 TCP Request. Address: {} 2026-03-09 11:12:41 40. 17100 0.006 1.61 MiB 0.006 1 222 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}. 2026-03-09 11:12:41 41. 17027 0.006 448.95 KiB 0.002 1 215 ['Debug'] 1 Done processing connection. 2026-03-09 11:12:41 42. 15968 0.006 561.39 KiB 0.002 1 41 ['Trace'] 1 Keeper request. Address: {} 2026-03-09 11:12:41 43. 15908 0.006 1.58 MiB 0.006 253 33 ['Debug'] 1 Fetching part {} from {}:{} 2026-03-09 11:12:41 44. 15772 0.005 1.65 MiB 0.006 1 71 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {} 2026-03-09 11:12:41 45. 14963 0.005 567.31 KiB 0.002 342 35 ['Debug'] 0.763 Committing part {} to zookeeper 2026-03-09 11:12:41 46. 14325 0.005 527.65 KiB 0.002 339 32 ['Debug'] 0.797 Part {} committed to zookeeper 2026-03-09 11:12:41 47. 13813 0.005 431.66 KiB 0.001 1 13 ['Debug'] 1 Receive four letter command {} 2026-03-09 11:12:41 48. 12250 0.004 442.59 KiB 0.002 252 40 ['Trace'] 1 Checking disk {} with type {} 2026-03-09 11:12:41 49. 12250 0.004 1.03 MiB 0.004 252 40 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select 2026-03-09 11:12:41 50. 12225 0.004 513.35 KiB 0.002 3577 254 ['Debug'] 0.011 Found {} non used tables in detached tables. 2026-03-09 11:12:41 51. 12225 0.004 728.25 KiB 0.003 3577 254 ['Debug'] 0.011 There are {} detached tables. Start searching non used tables. 2026-03-09 11:12:41 52. 12164 0.004 938.43 KiB 0.003 1 248 ['Trace'] 0 Query span trace_id for opentelemetry log: {} 2026-03-09 11:12:41 53. 11487 0.004 247.12 KiB 0.001 207 66 ['Trace'] 1 Sending part {} 2026-03-09 11:12:41 54. 11482 0.004 222.83 KiB 0.001 250 41 ['Debug'] 1 Downloading files {} 2026-03-09 11:12:41 55. 11479 0.004 975.25 KiB 0.003 250 41 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}' 2026-03-09 11:12:41 56. 11475 0.004 504.60 KiB 0.002 247 41 ['Debug'] 1 Downloading part {} onto disk {}. 2026-03-09 11:12:41 57. 11472 0.004 605.29 KiB 0.002 246 41 ['Debug'] 1 Download of part {} onto disk {} finished. 2026-03-09 11:12:41 58. 11415 0.004 1.10 MiB 0.004 249 33 ['Debug'] 1 Fetched part {} from {}:{}{} 2026-03-09 11:12:41 59. 11168 0.004 714.97 KiB 0.002 78 453 ['Debug'] 1 There is no part {} in ZooKeeper, it was only in filesystem 2026-03-09 11:12:41 60. 9478 0.003 379.49 KiB 0.001 190 539 ['Debug'] 0.556 Will use old analyzer to prepare mutation 2026-03-09 11:12:41 61. 9167 0.003 730.49 KiB 0.003 1 1111 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={} 2026-03-09 11:12:41 62. 8663 0.003 1.16 MiB 0.004 1 173 ['Trace'] 0.018 PREWHERE condition was split into {} steps: {} 2026-03-09 11:12:41 63. 8331 0.003 292.89 KiB 0.001 1 992 ['Trace'] 0.008 Converting aggregated data to blocks 2026-03-09 11:12:41 64. 8296 0.003 887.92 KiB 0.003 1 986 ['Debug'] 0.006 Converted aggregated data to blocks. {} rows, {} in {} sec. ({:.3f} rows/sec., {}/sec.) 2026-03-09 11:12:41 65. 8163 0.003 967.28 KiB 0.003 2958 16 ['Trace'] 1 Executing log entry to merge parts {} to {} 2026-03-09 11:12:41 66. 7864 0.003 296.59 KiB 0.001 368 189 ['Debug'] 0.011 Reading approx. {} rows with {} streams 2026-03-09 11:12:41 67. 7421 0.003 217.41 KiB 0.001 854 520 ['Debug'] 0.994 Updating strategy picker state 2026-03-09 11:12:41 68. 7363 0.003 287.62 KiB 0.001 1 1194 ['Debug'] 0.5 Spawn loader worker #{} in {} 2026-03-09 11:12:41 69. 7363 0.003 208.53 KiB 0.001 1 1151 ['Debug'] 1 Stop worker in {} 2026-03-09 11:12:41 70. 7363 0.003 512.71 KiB 0.002 1 1046 ['Debug'] 1 Finish load job '{}' with status {} 2026-03-09 11:12:41 71. 7363 0.003 541.48 KiB 0.002 1 1046 ['Debug'] 1 Execute load job '{}' in {} 2026-03-09 11:12:41 72. 7363 0.003 563.05 KiB 0.002 1 153 ['Debug'] 0.001 Schedule load job '{}' into {} 2026-03-09 11:12:41 73. 7362 0.003 685.20 KiB 0.002 1 153 ['Debug'] 0 Prioritize load job '{}': {} -> {} 2026-03-09 11:12:41 74. 7335 0.003 64.47 KiB 0 2 153 ['Trace'] 0.001 No tables 2026-03-09 11:12:41 75. 7312 0.003 242.78 KiB 0.001 1 1172 ['Debug'] 0.5 Change current priority: {} -> {} 2026-03-09 11:12:41 76. 7159 0.002 351.58 KiB 0.001 673 623 ['Debug'] 0.875 Selected {} parts from {} to {} 2026-03-09 11:12:41 77. 6774 0.002 231.09 KiB 0.001 368 144 ['Debug'] 0.001 MinMax index condition: {} 2026-03-09 11:12:41 78. 6710 0.002 834.49 KiB 0.003 12 510 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now. 2026-03-09 11:12:41 79. 6513 0.002 448.93 KiB 0.002 249 668 ['Trace'] 0.009 Running binary search on index range for part {} ({} marks) 2026-03-09 11:12:41 80. 6513 0.002 193.11 KiB 0.001 249 668 ['Trace'] 0.009 Found (RIGHT) boundary mark: {} 2026-03-09 11:12:41 81. 6513 0.002 200.16 KiB 0.001 249 668 ['Trace'] 0.009 Found {} range {}in {} steps 2026-03-09 11:12:41 82. 6513 0.002 186.32 KiB 0.001 249 668 ['Trace'] 0.009 Found (LEFT) boundary mark: {} 2026-03-09 11:12:41 83. 6512 0.002 1.27 MiB 0.005 1 1136 ['Information'] 1 Removing metadata {} of dropped table {} 2026-03-09 11:12:41 84. 6510 0.002 750.18 KiB 0.003 1 169 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {} 2026-03-09 11:12:41 85. 6510 0.002 483.16 KiB 0.002 1 169 ['Debug'] 0 Waiting for table {} to be finally dropped 2026-03-09 11:12:41 86. 6437 0.002 376.54 KiB 0.001 18 18 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {} 2026-03-09 11:12:41 87. 6437 0.002 234.66 KiB 0.001 18 18 ['Trace'] 1 Flushed system log up to offset {} 2026-03-09 11:12:41 88. 6310 0.002 1.27 MiB 0.005 1286 16 ['Debug'] 1 Don't have all parts (at least {} is missing) for merge {}; will try to fetch it instead. Either pool for fetches is starving, see background_fetches_pool_size, or none of active replicas has it 2026-03-09 11:12:41 89. 6133 0.002 443.23 KiB 0.002 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables 2026-03-09 11:12:41 90. 5908 0.002 547.47 KiB 0.002 15 28 ['Debug'] 0 Waiting for currently running merges ({} parts are merging right now) to perform OPTIMIZE FINAL 2026-03-09 11:12:41 91. 5791 0.002 1.10 MiB 0.004 1 266 ['Trace'] 0.001 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {} 2026-03-09 11:12:41 92. 5790 0.002 737.24 KiB 0.003 2236 1415 ['Debug'] 0.977 Removing {} parts from filesystem (serially): Parts: [{}] 2026-03-09 11:12:41 93. 5474 0.002 434.69 KiB 0.002 1 111 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {} 2026-03-09 11:12:41 94. 5474 0.002 186.51 KiB 0.001 1 111 ['Debug'] 0 Selected MergeAlgorithm: {} 2026-03-09 11:12:41 95. 5459 0.002 706.31 KiB 0.002 1 111 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec. 2026-03-09 11:12:41 96. 5444 0.002 329.62 KiB 0.001 509 111 ['Trace'] 0 Merged {} parts: [{}, {}] -> {} 2026-03-09 11:12:41 97. 5190 0.002 377.28 KiB 0.001 1 179 ['Trace'] 0.011 The min valid primary key position for moving to the tail of PREWHERE is {} 2026-03-09 11:12:41 98. 5055 0.002 303.80 KiB 0.001 36 32 ['Debug'] 1 Part {} is rendered obsolete by fetching part {} 2026-03-09 11:12:41 99. 5032 0.002 362.65 KiB 0.001 414 560 ['Debug'] 0 Wrote block with ID '{}', {} rows{} 2026-03-09 11:12:41 100. 4885 0.002 343.31 KiB 0.001 1 548 ['Trace'] 0.805 Rolling back transaction {}{} 2026-03-09 11:12:41 2026-03-09 11:12:41 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 2026-03-09 11:12:41 2026-03-09 11:12:41 2026-03-09 11:12:41 2026-03-09 11:12:41 Top messages without format string (fmt::runtime): 2026-03-09 11:12:41 2026-03-09 11:12:41 count pattern runtime_message line 2026-03-09 11:12:41 2026-03-09 11:12:41 1. 1524 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71) 2026-03-09 11:12:41 2. 22 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 32 ('DROP'): DROP COLUMN c. Expected one of: ALTER command, token, OpeningRoundBracket: In scope SELECT formatQuery('ALTER TABLE a (DROP COLUMN b), DROP COLUMN c'). (SYNTAX_ERROR) (version 24.8.14.1 ('/executeQuery.cpp',221) 2026-03-09 11:12:41 3. 12 CodeDBExceptionReceivedfromDBExc Code: 206. DB::Exception: Received from 127.1:9000. DB::Exception: No alias for subquery or table function in JOIN (set joined_subquery_requires_alias=0 to disable restriction). While processing ' view(SELECT dummy AS d1, dummy AS d2 FROM system.one)'. Sta ('/executeQuery.cpp',221) 2026-03-09 11:12:41 4. 8 CodeDBExceptionReceivedfromlocal Code: 242. DB::Exception: Received from localhost:9000. DB::Exception: Table is in readonly mode: replica_path=/tables/shard_1/data/replicas/read. Stack trace: 2026-03-09 11:12:41 2026-03-09 11:12:41 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String ('/executeQuery.cpp',221) 2026-03-09 11:12:41 5. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:34258) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SET ('/executeQuery.cpp',221) 2026-03-09 11:12:41 6. 4 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.8.14.10504.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:36178) (in query: ), Stack trace (when copying this message, always include the lines below): 2026-03-09 11:12:41 2026-03-09 11:12:41 0. /build/contrib/llvm-projec ('/executeQuery.cpp',221) 2026-03-09 11:12:41 7. 4 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT formatQuery(''). (SYNTAX_ERROR) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:46616) (comment: 02882_formatQuery.sql) (in query: SELECT formatQuery('');), Stack trace (when copying t ('/executeQuery.cpp',221) 2026-03-09 11:12:41 8. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221) 2026-03-09 11:12:41 9. 4 CodeDBExceptionEmptyquerywhileex Code: 62. DB::Exception: Empty query: while executing 'FUNCTION formatQuery(__table1.query : 2) -> formatQuery(__table1.query) String : 1'. (SYNTAX_ERROR) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:46616) (comment: 02882_formatQuery. ('/executeQuery.cpp',221) 2026-03-09 11:12:41 10. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:39402) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221) 2026-03-09 11:12:41 11. 2 CodeDBExceptionThereisnosubtypef Code: 386. DB::Exception: There is no subtype for types String, UInt8 because some of them are String/FixedString and some of them are not: In scope SELECT ['1', '2'] AS arr1, [1, 2] AS arr2, round(arrayJaccardIndex(arr1, arr2), 2). (NO_COMMON_TYPE) (versi ('/executeQuery.cpp',221) 2026-03-09 11:12:41 12. 2 CodeDBExceptionFailedtogetobject Code: 499. DB::Exception: Failed to get object info: No response body.. HTTP response code: 404: while reading test: The table structure cannot be extracted from a CSV format file. You can specify the structure manually. (S3_ERROR) (version 24.8.14.10504.a ('/executeQuery.cpp',221) 2026-03-09 11:12:41 13. 2 CodeDBExceptionOutofmemoryalloca Code: 173. DB::Exception: Out of memory: allocation of size 80003648 failed: (in file/uri /var/lib/clickhouse/user_files/03147_parquet_memory_tracking.parquet): While executing ParquetBlockInputFormat: While executing File. (CANNOT_ALLOCATE_MEMORY) (versio ('/executeQuery.cpp',221) 2026-03-09 11:12:41 14. 1 createsnapshotidxlogterm create snapshot idx 100000 log_term 1 ('/LoggerWrapper.h',43) 2026-03-09 11:12:41 15. 1 INITRAFTSERVERcommitindextermele === INIT RAFT SERVER === 2026-03-09 11:12:41 commit index 0 2026-03-09 11:12:41 term 0 2026-03-09 11:12:41 election timer allowed 2026-03-09 11:12:41 log store start 1, end 0 2026-03-09 11:12:41 config log idx 0, prev log idx 0 2026-03-09 11:12:41 -- ASYNC REPLICATION -- ('/LoggerWrapper.h',43) 2026-03-09 11:12:41 16. 1 FailedtorestorefrombackupShttplo Failed to restore from backup S3('http://localhost:11111/test/backups/test_qgx5qfbd/use_same_s3_credentials_for_base_backup_base_inc_1', 'test', '[HIDDEN]'): Code: 499. DB::Exception: The request signature we calculated does not match the signature you pro ('/Exception.cpp',273) 2026-03-09 11:12:41 17. 1 newelectiontimeoutrange new election timeout range: 0 - 0 ('/LoggerWrapper.h',43) 2026-03-09 11:12:41 18. 1 StartingClickHousealtinitytestre Starting ClickHouse 24.8.14.10504.altinitytest (revision: 4294967295, git hash: 3f8604df3ea74ce2eab3ad4a7634c2bcdb7aa858, build id: 2D62078B5B9551006D5124B2FF0637F85D3D64B4), PID 618 ('',0) 2026-03-09 11:12:41 19. 1 CodeDBExceptionstdruntimeerrorra Code: 1001. DB::Exception: std::runtime_error: ran out of bytes. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below): 2026-03-09 11:12:41 2026-03-09 11:12:41 0. /build/contrib/llvm-project/libcxx/include/exception:141: std::runtime_error::runtime_error(char ('/TCPHandler.cpp',765) 2026-03-09 11:12:41 20. 1 newconfiglogidxprevlogidxcurconf new config log idx 1, prev log idx 0, cur config log idx 0, prev log idx 0 ('/LoggerWrapper.h',43) 2026-03-09 11:12:41 21. 1 stdexceptionCodetypeavroExceptio std::exception. Code: 1001, type: avro::Exception, e.what() = Cannot read compressed data, expected at least 4 bytes, got 0 (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:39546) (comment: 02373_heap_buffer_overflow_in_avro.sh) (in query: ('/executeQuery.cpp',221) 2026-03-09 11:12:41 22. 1 FailedtomakebackupShttplocalhost Failed to make backup S3('http://localhost:11111/test/backups/test_qgx5qfbd/use_same_s3_credentials_for_base_backup_base_inc_3_bad', 'test', '[HIDDEN]'): Code: 499. DB::Exception: The request signature we calculated does not match the signature you provide ('/Exception.cpp',273) 2026-03-09 11:12:41 23. 1 createsnapshotidxlogtermdoneusel create snapshot idx 100000 log_term 1 done: 187 us elapsed ('/LoggerWrapper.h',43) 2026-03-09 11:12:41 24. 1 BECOMELEADERappendednewconfigat [BECOME LEADER] appended new config at 1 ('/LoggerWrapper.h',43) 2026-03-09 11:12:41 25. 1 parameterselectiontimeoutrangehe parameters: election timeout range 0 - 0, heartbeat 0, leadership expiry 0, max batch 100, backoff 50, snapshot distance 100000, enable randomized snapshot creation NO, log sync stop gap 99999, reserved logs 2147483647, client timeout 10000, auto forwardin ('/LoggerWrapper.h',43) 2026-03-09 11:12:41 26. 1 CodeDBExceptionavroExceptionCann Code: 1001. DB::Exception: avro::Exception: Cannot read compressed data, expected at least 4 bytes, got 0. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below): 2026-03-09 11:12:41 2026-03-09 11:12:41 0. /build/contrib/llvm-project/libcxx/include/exception:14 ('/TCPHandler.cpp',765) 2026-03-09 11:12:41 27. 1 VOTEINITmyidmyrolecandidateterml [VOTE INIT] my id 1, my role candidate, term 1, log idx 0, log term 0, priority (target 1 / mine 1) ('/LoggerWrapper.h',43) 2026-03-09 11:12:41 28. 1 peerDCIDlocalhostvotingmembermyi peer 1: DC ID 0, localhost:9234, voting member, 1 2026-03-09 11:12:41 my id: 1, voting_member 2026-03-09 11:12:41 num peers: 0 ('/LoggerWrapper.h',43) 2026-03-09 11:12:41 29. 1 globalmanagerdoesnotexistwilluse global manager does not exist. will use local thread for commit and append ('/LoggerWrapper.h',43) 2026-03-09 11:12:47 30. 1 configatindexiscommittedprevconf config at index 1 is committed, prev config log idx 0 ('/LoggerWrapper.h',43) 2026-03-09 11:12:47 2026-03-09 11:12:47 2026-03-09 11:12:47 2026-03-09 11:12:47 Top messages not matching their format strings: 2026-03-09 11:12:47 2026-03-09 11:12:47 message_format_string count() any_message 2026-03-09 11:12:47 2026-03-09 11:12:47 1. 1554 If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. 2026-03-09 11:12:47 message_format_string count() any_message 2026-03-09 11:12:47 2026-03-09 11:12:47 2. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:45458) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below): 2026-03-09 11:12:47 2026-03-09 11:12:47 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000001648d2b2 2026-03-09 11:12:47 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c652179 2026-03-09 11:12:47 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000701116c 2026-03-09 11:12:47 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x0000000007af8fcb 2026-03-09 11:12:47 4. /build/src/Functions/FunctionsStringDistance.cpp:0: DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x0000000007af881c 2026-03-09 11:12:47 5. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000007b027b7 2026-03-09 11:12:47 6. /build/src/Common/PODArray.h:208: DB::FunctionStringDistanceImpl>::vectorVector(DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul>&, unsigned long) @ 0x0000000007b023cf 2026-03-09 11:12:47 7. /build/src/Functions/FunctionsStringSimilarity.h:0: DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000007b01c2f 2026-03-09 11:12:47 8. /build/src/Functions/IFunctionAdaptors.h:22: DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000702697a 2026-03-09 11:12:47 9. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69ca5 2026-03-09 11:12:47 10. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6a71a 2026-03-09 11:12:47 11. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6b645 2026-03-09 11:12:47 12. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x000000001119cb1d 2026-03-09 11:12:47 13. /build/src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x0000000012fb8176 2026-03-09 11:12:47 14. /build/contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x000000000c90c4d3 2026-03-09 11:12:47 15. /build/src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x0000000012d5af49 2026-03-09 11:12:47 16. /build/src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x0000000012d75769 2026-03-09 11:12:47 17. /build/src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x0000000012d6b410 2026-03-09 11:12:47 18. /build/contrib/llvm-project/libcxx/include/vector:547: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x0000000012d6b69d 2026-03-09 11:12:47 19. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x0000000012d6a50c 2026-03-09 11:12:47 20. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x0000000012d69f25 2026-03-09 11:12:47 21. /build/src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:0: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x0000000012d785ea 2026-03-09 11:12:47 22. /build/base/base/../base/wide_integer_impl.h:817: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x000000000c706d2e 2026-03-09 11:12:47 23. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000000c70c192 2026-03-09 11:12:47 24. ? @ 0x00007f80e62bcac3 2026-03-09 11:12:47 25. ? @ 0x00007f80e634e850 2026-03-09 11:12:47 2026-03-09 11:12:47 message_format_string count() any_message 2026-03-09 11:12:47 2026-03-09 11:12:47 3. Close WriteBufferFromAzureBlobStorage. {}. 4 Close WriteBufferFromAzureBlobStorage. geygffmpdvfhxpcgzprbqcctutccozbc. (LogSeriesLimiter: on interval from 2026-03-09 10:52:49 to 2026-03-09 10:53:21 accepted series 1 / 10 for the logger WriteBufferFromAzureBlobStorage) 2026-03-09 11:12:47 message_format_string count() any_message 2026-03-09 11:12:47 2026-03-09 11:12:47 4. Substitution '\{}' in replacement argument is invalid, regexp has only {} capturing groups 4 Code: 36. DB::Exception: Substitution '\1' in replacement argument is invalid, regexp has only 0 capturing groups. (BAD_ARGUMENTS) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:36030) (comment: 02864_replace_regexp_string_fallback.sql) (in query: -- negative tests 2026-03-09 11:12:47 -- Even if the fallback is used, invalid substitutions must throw an exception. 2026-03-09 11:12:47 SELECT 'Hello' AS haystack, 'l' AS needle, '\\1' AS replacement, replaceRegexpOne(materialize(haystack), needle, replacement);), Stack trace (when copying this message, always include the lines below): 2026-03-09 11:12:47 2026-03-09 11:12:47 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000001648d2b2 2026-03-09 11:12:47 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c652179 2026-03-09 11:12:47 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000701116c 2026-03-09 11:12:47 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, int&, int&&) @ 0x000000000b5827ab 2026-03-09 11:12:47 4. /build/src/Functions/ReplaceRegexpImpl.h:0: DB::ReplaceRegexpImpl::checkSubstitutions(std::basic_string_view>, int) @ 0x000000000b586eee 2026-03-09 11:12:47 5. /build/contrib/llvm-project/libcxx/include/string:1624: DB::FunctionStringReplace, DB::(anonymous namespace)::NameReplaceRegexpOne>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000b583b51 2026-03-09 11:12:47 6. /build/src/Functions/IFunction.h:448: DB::IFunction::executeImplDryRun(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000701034a 2026-03-09 11:12:47 7. /build/src/Functions/IFunctionAdaptors.h:28: DB::FunctionToExecutableFunctionAdaptor::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x00000000070269da 2026-03-09 11:12:47 8. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69c8f 2026-03-09 11:12:47 9. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6a71a 2026-03-09 11:12:47 10. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6b645 2026-03-09 11:12:47 11. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ActionsDAG::evaluatePartialResult(std::unordered_map, std::equal_to, std::allocator>>&, std::vector> const&, unsigned long, bool) @ 0x0000000010fd0041 2026-03-09 11:12:47 12. /build/src/Interpreters/ActionsDAG.cpp:0: DB::ActionsDAG::updateHeader(DB::Block const&) const @ 0x0000000010fcf054 2026-03-09 11:12:47 13. /build/src/Processors/Transforms/ExpressionTransform.cpp:10: DB::ExpressionTransform::transformHeader(DB::Block const&, DB::ActionsDAG const&) @ 0x0000000012fb7e32 2026-03-09 11:12:47 14. /build/src/Processors/QueryPlan/ExpressionStep.cpp:20: DB::ExpressionStep::ExpressionStep(DB::DataStream const&, DB::ActionsDAG) @ 0x000000001314afb4 2026-03-09 11:12:47 15. /build/contrib/llvm-project/libcxx/include/vector:438: std::__unique_if::__unique_single std::make_unique[abi:v15007](DB::DataStream const&, DB::ActionsDAG&&) @ 0x00000000104c74da 2026-03-09 11:12:47 16. /build/src/Planner/Planner.cpp:0: DB::(anonymous namespace)::addExpressionStep(DB::QueryPlan&, std::shared_ptr&, String const&, std::unordered_set, std::hash>, std::equal_to>, std::allocator>>&) @ 0x0000000011659e3c 2026-03-09 11:12:47 17. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Planner::buildPlanForQueryNode() @ 0x00000000116542aa 2026-03-09 11:12:47 18. /build/src/Planner/Planner.cpp:0: DB::Planner::buildQueryPlanIfNeeded() @ 0x000000001164f79e 2026-03-09 11:12:47 19. /build/src/Planner/Planner.h:44: DB::InterpreterSelectQueryAnalyzer::getQueryPlan() @ 0x000000001164d98d 2026-03-09 11:12:47 20. /build/src/Interpreters/executeQuery.cpp:1182: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x0000000011915e6d 2026-03-09 11:12:47 21. /build/src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x0000000011911add 2026-03-09 11:12:47 22. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x0000000012cbf97b 2026-03-09 11:12:47 23. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:593: DB::TCPHandler::run() @ 0x0000000012cd6139 2026-03-09 11:12:47 24. /build/base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x0000000016532887 2026-03-09 11:12:47 25. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x0000000016532d5e 2026-03-09 11:12:47 26. /build/base/poco/Foundation/src/ThreadPool.cpp:219: Poco::PooledThread::run() @ 0x00000000164df572 2026-03-09 11:12:47 27. /build/base/poco/Foundation/include/Poco/AutoPtr.h:77: Poco::ThreadImpl::runnableEntry(void*) @ 0x00000000164dd283 2026-03-09 11:12:47 28. ? @ 0x00007f80e62bcac3 2026-03-09 11:12:47 29. ? @ 0x00007f80e634e850 2026-03-09 11:12:47 2026-03-09 11:12:47 message_format_string count() any_message 2026-03-09 11:12:47 2026-03-09 11:12:49 5. (from {}{}{}){}{} {} (stage: {}) 3 (from [::1]:46184) (comment: 01674_unicode_asan.sql) SELECT positionCaseInsensitiveUTF8('иголка.ру', 'иголка.р�\0') AS res; (stage: Complete) 2026-03-09 11:12:49 2026-03-09 11:12:49 2026-03-09 11:12:49 2026-03-09 11:12:49 Top short messages: 2026-03-09 11:12:49 2026-03-09 11:12:49 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-09 11:12:49 2026-03-09 11:12:49 1. 113 {} Server was built in debug mode. It will work slowly. 26 2026-03-09 11:12:49 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-09 11:12:49 2026-03-09 11:12:49 2. 19 Creating {}: {} Creating table test_njph0zqc.test: CREATE TABLE IF NOT EXISTS test_njph0zqc.test UUID '5920abc0-16d8-4cc0-a395-589b4d5f3 124 2026-03-09 11:12:49 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-09 11:12:49 2026-03-09 11:12:49 3. 12 Froze {} parts Froze 1 parts -13 2026-03-09 11:12:49 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-09 11:12:49 2026-03-09 11:12:49 4. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.8.14.10504.altinitytest (altinity buil 29 2026-03-09 11:12:49 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-09 11:12:49 2026-03-09 11:12:49 5. 4 Unknown data type family: {} Code: 50. DB::Exception: Unknown data type family: ab. (UNKNOWN_TYPE) (version 24.8.14.10504.altinitytest (altinity buil 29 2026-03-09 11:12:49 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-09 11:12:49 2026-03-09 11:12:49 6. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING) (version 24.8.14.10504.altinitytest (altinity bui 27 2026-03-09 11:12:49 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-09 11:12:49 2026-03-09 11:12:49 7. 2 Substitution {} is not set Code: 456. DB::Exception: Substitution `s` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.8.14.10504.altinitytest (al 29 2026-03-09 11:12:49 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-09 11:12:49 2026-03-09 11:12:49 8. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10504.altinitytest (altinity build) 24 2026-03-09 11:12:49 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-09 11:12:49 2026-03-09 11:12:49 9. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.8.14.10504.altinitytest (altinity build 27 2026-03-09 11:12:49 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-09 11:12:49 2026-03-09 11:12:49 10. 2 Table {} is not empty Code: 705. DB::Exception: Table tab2 is not empty. (TABLE_NOT_EMPTY) (version 24.8.14.10504.altinitytest (altinity build 25 2026-03-09 11:12:49 2026-03-09 11:12:49 2026-03-09 11:12:49 2026-03-09 11:12:49 Top messages by level: 2026-03-09 11:12:49 2026-03-09 11:12:49 (0.0008442195971509152,'Failed to push block to view {}, {}') Error 2026-03-09 11:12:49 (0.00039501139175332945,'Not enabled four letter command {}') Warning 2026-03-09 11:12:49 (0.0022623695541756214,'Removing metadata {} of dropped table {}') Information 2026-03-09 11:12:49 (0.042229740293038005,'(from {}{}{}){}{} {} (stage: {})') Debug 2026-03-09 11:12:49 (0.07831995436350359,'is disk {} eligible for search: {}') Trace 2026-03-09 11:12:49 2026-03-09 11:12:49 + set -e + echo 'Files in current directory' + ls -la ./ Files in current directory total 129396 drwxr-xr-x 1 root root 4096 Mar 9 11:05 . drwxr-xr-x 1 root root 4096 Mar 9 11:05 .. -rw-rw-r-- 1 1000 1000 119 Mar 9 10:19 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib -rw-r--r-- 1 root root 1541 Mar 9 11:05 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 4241 Mar 9 10:53 __azurite_db_blob__.json -rw-r--r-- 1 root root 2054320 Mar 9 11:12 azurite_log lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin drwxr-xr-x 2 root root 4096 Mar 9 11:05 __blobstorage__ drwxr-xr-x 2 root root 4096 Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 966 Mar 9 10:19 broken_tests.json drwxr-x--- 4 root root 4096 Mar 9 10:51 data drwxr-xr-x 14 root root 3840 Mar 9 10:24 dev -rwxr-xr-x 1 root root 0 Mar 9 10:24 .dockerenv drwxr-xr-x 1 root root 4096 Mar 9 10:25 etc drwxr-x--- 2 root root 4096 Mar 9 10:51 flags drwxr-x--- 2 root root 4096 Mar 9 10:51 format_schemas drwxr-xr-x 1 1000 1000 4096 Mar 9 10:25 hadoop-3.3.1 drwxr-xr-x 2 root root 4096 Apr 18 2022 home lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26927256 Jan 31 2025 mc drwxr-xr-x 2 root root 4096 Sep 11 2024 media drwxr-x--- 2 root root 4096 Mar 9 10:51 metadata drwxr-x--- 2 root root 4096 Mar 9 10:51 metadata_dropped -rwxr-xr-x 1 root root 103174296 Jan 31 2025 minio drwxr-xr-x 4 root root 4096 Mar 9 10:25 minio_data drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt drwxr-xr-x 1 root root 4096 Jan 31 2025 opt -rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4096 Mar 9 10:24 package_folder drwxr-x--- 2 root root 4096 Mar 9 10:55 preprocessed_configs dr-xr-xr-x 314 root root 0 Mar 9 10:24 proc -rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py -rw-r--r-- 1 root root 29 Mar 9 10:29 queries_02352 -rw-r----- 1 root root 1 Mar 9 10:51 quotas.list -rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt -rw-r----- 1 root root 1 Mar 9 10:51 roles.list drwx------ 1 root root 4096 Mar 9 11:10 root -rw-r----- 1 root root 1 Mar 9 10:51 row_policies.list drwxr-xr-x 1 root root 4096 Mar 9 10:25 run -rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin -rw-r--r-- 1 root root 747 Mar 9 10:25 script.gdb -rw-r--r-- 1 root root 65798 Mar 9 10:57 server.log -rw-r----- 1 root root 1 Mar 9 10:51 settings_profiles.list -rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh drwxr-xr-x 2 root root 4096 Sep 11 2024 srv -rw-r----- 1 root root 65 Mar 9 10:55 status drwxr-x--- 4 root root 4096 Mar 9 10:51 store -rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Mar 9 10:24 sys drwxrwxr-x 2 1000 1000 4096 Mar 9 10:26 test_output drwxrwxrwt 1 root root 4096 Mar 9 11:12 tmp drwxr-x--- 2 root root 4096 Mar 9 10:51 user_files -rw-r----- 1 root root 1 Mar 9 10:54 users.list drwxr-xr-x 1 root root 4096 Sep 11 2024 usr -rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib -rw-r----- 1 root root 36 Mar 9 10:51 uuid drwxr-xr-x 1 root root 4096 Sep 11 2024 var + echo 'Files in root directory' + ls -la / Files in root directory total 129396 drwxr-xr-x 1 root root 4096 Mar 9 11:05 . drwxr-xr-x 1 root root 4096 Mar 9 11:05 .. -rw-rw-r-- 1 1000 1000 119 Mar 9 10:19 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib -rw-r--r-- 1 root root 1541 Mar 9 11:05 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 4241 Mar 9 10:53 __azurite_db_blob__.json -rw-r--r-- 1 root root 2054320 Mar 9 11:12 azurite_log lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin drwxr-xr-x 2 root root 4096 Mar 9 11:05 __blobstorage__ drwxr-xr-x 2 root root 4096 Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 966 Mar 9 10:19 broken_tests.json drwxr-x--- 4 root root 4096 Mar 9 10:51 data drwxr-xr-x 14 root root 3840 Mar 9 10:24 dev -rwxr-xr-x 1 root root 0 Mar 9 10:24 .dockerenv drwxr-xr-x 1 root root 4096 Mar 9 10:25 etc drwxr-x--- 2 root root 4096 Mar 9 10:51 flags drwxr-x--- 2 root root 4096 Mar 9 10:51 format_schemas drwxr-xr-x 1 1000 1000 4096 Mar 9 10:25 hadoop-3.3.1 drwxr-xr-x 2 root root 4096 Apr 18 2022 home lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26927256 Jan 31 2025 mc drwxr-xr-x 2 root root 4096 Sep 11 2024 media drwxr-x--- 2 root root 4096 Mar 9 10:51 metadata drwxr-x--- 2 root root 4096 Mar 9 10:51 metadata_dropped -rwxr-xr-x 1 root root 103174296 Jan 31 2025 minio drwxr-xr-x 4 root root 4096 Mar 9 10:25 minio_data drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt drwxr-xr-x 1 root root 4096 Jan 31 2025 opt -rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4096 Mar 9 10:24 package_folder drwxr-x--- 2 root root 4096 Mar 9 10:55 preprocessed_configs dr-xr-xr-x 314 root root 0 Mar 9 10:24 proc -rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py -rw-r--r-- 1 root root 29 Mar 9 10:29 queries_02352 -rw-r----- 1 root root 1 Mar 9 10:51 quotas.list -rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt -rw-r----- 1 root root 1 Mar 9 10:51 roles.list drwx------ 1 root root 4096 Mar 9 11:10 root -rw-r----- 1 root root 1 Mar 9 10:51 row_policies.list drwxr-xr-x 1 root root 4096 Mar 9 10:25 run -rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin -rw-r--r-- 1 root root 747 Mar 9 10:25 script.gdb -rw-r--r-- 1 root root 65798 Mar 9 10:57 server.log -rw-r----- 1 root root 1 Mar 9 10:51 settings_profiles.list -rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh drwxr-xr-x 2 root root 4096 Sep 11 2024 srv -rw-r----- 1 root root 65 Mar 9 10:55 status drwxr-x--- 4 root root 4096 Mar 9 10:51 store -rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Mar 9 10:24 sys drwxrwxr-x 2 1000 1000 4096 Mar 9 10:26 test_output drwxrwxrwt 1 root root 4096 Mar 9 11:12 tmp drwxr-x--- 2 root root 4096 Mar 9 10:51 user_files -rw-r----- 1 root root 1 Mar 9 10:54 users.list drwxr-xr-x 1 root root 4096 Sep 11 2024 usr -rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib -rw-r----- 1 root root 36 Mar 9 10:51 uuid drwxr-xr-x 1 root root 4096 Sep 11 2024 var + /process_functional_tests_result.py 2026-03-09 11:12:49,624 File /analyzer_tech_debt.txt with broken tests found 2026-03-09 11:12:49,625 File /broken_tests.json with broken tests found 2026-03-09 11:12:49,626 Broken tests in the list: 4 2026-03-09 11:12:49,626 Find files in result folder test_result.txt,gdb.log,run.log,minio.log,hdfs_minicluster.log 2026-03-09 11:12:49,645 Is flaky check: False 2026-03-09 11:12:49,645 Result parsed 2026-03-09 11:12:49,651 Result written + clickhouse-client -q 'system flush logs' + stop_logs_replication + echo 'Detach all logs replication' Detach all logs replication + clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')' + tee /dev/stderr + timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}' xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value + failed_to_save_logs=0 + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + sleep 1 + clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE' + clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow' + clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow' + sudo clickhouse stop script.gdb:13: Error in sourced command file: No stack. /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 618. The process with pid = 618 is running. Sent terminate signal to process with pid 618. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 618. The process with pid = 618 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 618. The process with pid = 618 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 618. The process with pid = 618 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 618. The process with pid = 618 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 618. The process with pid = 618 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 618. The process with pid = 618 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 618. The process with pid = 618 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 618. The process with pid = 618 does not exist. Server stopped + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + kill 1500 + rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log + : + rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log + : + data_path_config=--path=/var/lib/clickhouse/ + zstd --threads=0 + [[ -n '' ]] + '[' 0 -ne 0 ']' + for trace_type in CPU Memory Real + zstd --threads=0 + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''CPU'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''Memory'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''Real'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + check_logs_for_critical_errors + sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log + rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp + echo -e 'No sanitizer asserts\tOK\t\N\t' + rm -f /test_output/tmp + rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t' + rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No logical errors\tOK\t\N\t' + '[' -s /test_output/logical_errors.txt ']' + rm /test_output/logical_errors.txt + rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + grep -v a.myext + echo -e 'No lost s3 keys\tOK\t\N\t' + grep SharedMergeTreePartCheckThread + rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/no_such_key_errors.txt ']' + rm /test_output/no_such_key_errors.txt + rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'Not crashed\tOK\t\N\t' + rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/fatal_messages.txt ']' + rm /test_output/fatal_messages.txt + rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/gdb.log /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst + rg -Fa ' received signal ' /test_output/gdb.log + dmesg -T + grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log + echo -e 'No OOM in dmesg\tOK\t\N\t' + rm /var/log/clickhouse-server/clickhouse-server.log + mv /var/log/clickhouse-server/stderr.log /test_output/ + [[ -n '' ]] + tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/ + tar -chf /test_output/store.tar /var/lib/clickhouse/store tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/03147_db.sql /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/empty_db_01036.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_6mlszt2j.sql /var/lib/clickhouse/metadata/test_kvvswux9_1.sql /var/lib/clickhouse/metadata/test_p43lk6tz.sql /var/lib/clickhouse/metadata/test.sql tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + collect_core_dumps + read -r core + find . -type f -maxdepth 1 -name 'core.*'